Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M8MZ63

Protein Details
Accession A0A0M8MZ63    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MLKRHIRTHTKPTKCPKEGCBasic
NLS Segment(s)
PositionSequence
81-91AKVRRKRGPKG
Subcellular Location(s) mito 14, cyto_nucl 7, nucl 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MLKRHIRTHTKPTKCPKEGCDAAGDFGKFIARHVWTDHTKWAEETNFPRIDGKCPHCGRSFKRKDFVTRHVREQHPADGEAKVRRKRGPKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.72
4 0.72
5 0.66
6 0.58
7 0.53
8 0.43
9 0.38
10 0.35
11 0.31
12 0.21
13 0.17
14 0.18
15 0.12
16 0.12
17 0.15
18 0.13
19 0.14
20 0.16
21 0.22
22 0.22
23 0.24
24 0.28
25 0.26
26 0.25
27 0.24
28 0.25
29 0.2
30 0.21
31 0.21
32 0.23
33 0.22
34 0.22
35 0.25
36 0.23
37 0.26
38 0.29
39 0.31
40 0.34
41 0.36
42 0.39
43 0.42
44 0.48
45 0.5
46 0.54
47 0.61
48 0.58
49 0.64
50 0.64
51 0.67
52 0.68
53 0.71
54 0.71
55 0.65
56 0.67
57 0.69
58 0.67
59 0.64
60 0.6
61 0.57
62 0.49
63 0.47
64 0.4
65 0.33
66 0.36
67 0.38
68 0.43
69 0.43
70 0.46
71 0.52