Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M8N6E9

Protein Details
Accession A0A0M8N6E9    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
43-62VSFRKHDGKRRDKRKGSGGGBasic
NLS Segment(s)
PositionSequence
46-88RKHDGKRRDKRKGSGGGGRRVGKGGARKADPLKTFKARRKTGK
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
Gene Ontology GO:0004386  F:helicase activity  
Amino Acid Sequences MKHLRHDGELRTARQQAHLKHVPEYLLPKDGQKALTADKVGFVSFRKHDGKRRDKRKGSGGGGRRVGKGGARKADPLKTFKARRKTGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.43
4 0.46
5 0.5
6 0.46
7 0.44
8 0.45
9 0.38
10 0.34
11 0.35
12 0.28
13 0.24
14 0.23
15 0.21
16 0.22
17 0.23
18 0.21
19 0.18
20 0.18
21 0.17
22 0.19
23 0.18
24 0.16
25 0.14
26 0.14
27 0.13
28 0.12
29 0.1
30 0.11
31 0.11
32 0.17
33 0.21
34 0.24
35 0.32
36 0.42
37 0.52
38 0.59
39 0.69
40 0.74
41 0.76
42 0.79
43 0.8
44 0.79
45 0.74
46 0.72
47 0.69
48 0.66
49 0.65
50 0.62
51 0.53
52 0.45
53 0.4
54 0.35
55 0.36
56 0.35
57 0.35
58 0.35
59 0.4
60 0.43
61 0.5
62 0.51
63 0.48
64 0.49
65 0.53
66 0.6
67 0.63
68 0.69