Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M8N983

Protein Details
Accession A0A0M8N983    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-74RAVPKNKVSHSKKRHRQMAGBasic
NLS Segment(s)
PositionSequence
65-70SKKRHR
Subcellular Location(s) mito 17, nucl 4, plas 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAAISASFLPRLSMPFSFQTRRFIVPFLPSLSIAVPGVSLNLPGLLGDIWESVLRAVPKNKVSHSKKRHRQMAGKALKDVNHLCKCPGCGELKRTHRLCQNCLEDMRRIWRQDYPSKSPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.29
4 0.34
5 0.35
6 0.39
7 0.39
8 0.42
9 0.39
10 0.35
11 0.32
12 0.3
13 0.3
14 0.27
15 0.25
16 0.21
17 0.21
18 0.19
19 0.18
20 0.13
21 0.11
22 0.08
23 0.06
24 0.07
25 0.06
26 0.06
27 0.05
28 0.05
29 0.05
30 0.04
31 0.05
32 0.03
33 0.03
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.06
41 0.07
42 0.09
43 0.11
44 0.15
45 0.19
46 0.21
47 0.24
48 0.32
49 0.39
50 0.47
51 0.56
52 0.62
53 0.68
54 0.75
55 0.81
56 0.77
57 0.78
58 0.77
59 0.77
60 0.75
61 0.67
62 0.61
63 0.55
64 0.48
65 0.44
66 0.39
67 0.38
68 0.34
69 0.33
70 0.31
71 0.31
72 0.32
73 0.29
74 0.3
75 0.26
76 0.27
77 0.32
78 0.4
79 0.45
80 0.53
81 0.54
82 0.56
83 0.58
84 0.59
85 0.57
86 0.57
87 0.55
88 0.51
89 0.53
90 0.51
91 0.48
92 0.46
93 0.49
94 0.46
95 0.43
96 0.41
97 0.43
98 0.47
99 0.52
100 0.57