FuNGI

A0A0M9VV78

Protein Details

Accession

A0A0M9VV78

Localization Confidence

High

Confidence Score

19.7

NoLS Segment(s)

Position	Sequence	Protein Nature
91-120	KIAPVVKDTQPKRPKKQKEEKTSFNRAPKT	Hydrophilic

NLS Segment(s)

Position	Sequence
101-117	PKRPKKQKEEKTSFNRA
410-421	SKKGKSLKRAGS
433-440	SRKKLKKA
544-550	KRLRRRK

Subcellular Location(s)

nucl 20, cyto 6

Family & Domain DBs

InterPro	View protein in InterPro IPR008851 TFIIF-alpha IPR011039 TFIIF_interaction
Gene Ontology	GO:0005634 C:nucleus GO:0003677 F:DNA binding GO:0003743 F:translation initiation factor activity GO:0032968 P:positive regulation of transcription elongation by RNA polymerase II GO:0006367 P:transcription initiation at RNA polymerase II promoter

Amino Acid Sequences

MTTKKALLDGIRYHMMKFTQAKLDDKPVDPTDQDEFARPVTLHRRDARQPPPGRAVKVEEPEKPPVDQHEIERLAQIKAEREAQRAIDQAKIAPVVKDTQPKRPKKQKEEKTSFNRAPKTSAAKKESDLRYEEALPWHLEDVDGKNIWVGSYVAALSEANVAFVIDKSVFRMVPLEKWYRFTAKPPFQPFTIDQAEAFMNRKVDVGRWVMKDEEKRAGLVDLEATRRLLSGRGQMIKRESETFRMASRSEKMEHDELDMSGDEFQDDDETPHFERNDDEETKESKDRIRREQLGANLFGDGDEQEVDRELQELLREELERQKYGKTTKKALIKRDREDIYESDDSNDNPWSSSSEESSDEDEDEANKEEDKKDGEGKEGQAEGKDKDKAKSLGNKGTSTPQSLQKQAEASKKGKSLKRAGSPALSESSGNESSRKKLKKASAAAAAAAAAAAAAPGSRSGTPLPTTNTVRRPKIAVGSGSDGEVTAGGGVIEPWEILEKVPAEGIAIGDLIRPFQGRVGEGPGRMPKGEWIKLVKQLCDYGPDKRLRRRK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.38
2	0.35
3	0.36
4	0.36
5	0.36
6	0.37
7	0.41
8	0.44
9	0.45
10	0.53
11	0.51
12	0.48
13	0.5
14	0.44
15	0.45
16	0.41
17	0.4
18	0.35
19	0.33
20	0.32
21	0.29
22	0.28
23	0.24
24	0.27
25	0.23
26	0.26
27	0.32
28	0.38
29	0.43
30	0.47
31	0.54
32	0.58
33	0.68
34	0.7
35	0.7
36	0.7
37	0.68
38	0.73
39	0.71
40	0.67
41	0.61
42	0.6
43	0.57
44	0.59
45	0.57
46	0.54
47	0.52
48	0.56
49	0.55
50	0.48
51	0.43
52	0.4
53	0.42
54	0.38
55	0.37
56	0.4
57	0.4
58	0.4
59	0.41
60	0.37
61	0.3
62	0.3
63	0.28
64	0.22
65	0.22
66	0.3
67	0.29
68	0.31
69	0.33
70	0.33
71	0.35
72	0.36
73	0.34
74	0.29
75	0.27
76	0.25
77	0.24
78	0.25
79	0.22
80	0.18
81	0.18
82	0.19
83	0.23
84	0.31
85	0.32
86	0.4
87	0.49
88	0.58
89	0.67
90	0.74
91	0.8
92	0.82
93	0.91
94	0.9
95	0.92
96	0.92
97	0.91
98	0.89
99	0.89
100	0.85
101	0.82
102	0.79
103	0.69
104	0.63
105	0.59
106	0.59
107	0.58
108	0.59
109	0.56
110	0.52
111	0.53
112	0.58
113	0.56
114	0.52
115	0.46
116	0.4
117	0.38
118	0.37
119	0.37
120	0.3
121	0.28
122	0.24
123	0.21
124	0.19
125	0.15
126	0.14
127	0.14
128	0.14
129	0.16
130	0.15
131	0.15
132	0.15
133	0.15
134	0.14
135	0.13
136	0.1
137	0.06
138	0.07
139	0.07
140	0.06
141	0.07
142	0.06
143	0.06
144	0.08
145	0.08
146	0.07
147	0.07
148	0.07
149	0.07
150	0.07
151	0.08
152	0.06
153	0.06
154	0.08
155	0.11
156	0.1
157	0.1
158	0.14
159	0.14
160	0.18
161	0.23
162	0.28
163	0.27
164	0.31
165	0.33
166	0.35
167	0.35
168	0.37
169	0.41
170	0.43
171	0.5
172	0.53
173	0.53
174	0.48
175	0.52
176	0.47
177	0.43
178	0.39
179	0.31
180	0.24
181	0.23
182	0.23
183	0.2
184	0.2
185	0.14
186	0.11
187	0.11
188	0.12
189	0.11
190	0.12
191	0.15
192	0.18
193	0.22
194	0.23
195	0.24
196	0.25
197	0.28
198	0.31
199	0.3
200	0.31
201	0.25
202	0.24
203	0.23
204	0.22
205	0.18
206	0.15
207	0.14
208	0.11
209	0.12
210	0.12
211	0.11
212	0.11
213	0.11
214	0.11
215	0.1
216	0.1
217	0.14
218	0.19
219	0.24
220	0.25
221	0.27
222	0.3
223	0.3
224	0.3
225	0.29
226	0.25
227	0.23
228	0.25
229	0.24
230	0.22
231	0.23
232	0.22
233	0.2
234	0.21
235	0.2
236	0.2
237	0.2
238	0.22
239	0.22
240	0.22
241	0.21
242	0.19
243	0.16
244	0.15
245	0.13
246	0.1
247	0.08
248	0.08
249	0.06
250	0.05
251	0.05
252	0.05
253	0.05
254	0.06
255	0.06
256	0.08
257	0.09
258	0.11
259	0.11
260	0.11
261	0.11
262	0.14
263	0.18
264	0.17
265	0.18
266	0.18
267	0.2
268	0.22
269	0.23
270	0.21
271	0.2
272	0.26
273	0.3
274	0.36
275	0.42
276	0.44
277	0.46
278	0.49
279	0.49
280	0.46
281	0.42
282	0.34
283	0.26
284	0.21
285	0.17
286	0.13
287	0.08
288	0.05
289	0.04
290	0.04
291	0.04
292	0.05
293	0.05
294	0.05
295	0.06
296	0.05
297	0.05
298	0.06
299	0.07
300	0.08
301	0.09
302	0.09
303	0.1
304	0.16
305	0.19
306	0.19
307	0.19
308	0.2
309	0.23
310	0.3
311	0.38
312	0.36
313	0.39
314	0.44
315	0.52
316	0.56
317	0.62
318	0.65
319	0.66
320	0.65
321	0.67
322	0.62
323	0.55
324	0.53
325	0.44
326	0.41
327	0.34
328	0.31
329	0.25
330	0.24
331	0.22
332	0.2
333	0.2
334	0.13
335	0.11
336	0.11
337	0.11
338	0.12
339	0.13
340	0.12
341	0.13
342	0.14
343	0.15
344	0.17
345	0.16
346	0.15
347	0.14
348	0.13
349	0.12
350	0.11
351	0.12
352	0.1
353	0.1
354	0.12
355	0.12
356	0.14
357	0.16
358	0.17
359	0.21
360	0.22
361	0.24
362	0.26
363	0.26
364	0.28
365	0.27
366	0.25
367	0.21
368	0.22
369	0.2
370	0.22
371	0.26
372	0.25
373	0.25
374	0.31
375	0.32
376	0.36
377	0.44
378	0.46
379	0.49
380	0.51
381	0.5
382	0.46
383	0.5
384	0.46
385	0.41
386	0.37
387	0.38
388	0.38
389	0.41
390	0.41
391	0.36
392	0.39
393	0.4
394	0.45
395	0.42
396	0.4
397	0.41
398	0.46
399	0.51
400	0.51
401	0.53
402	0.54
403	0.57
404	0.63
405	0.63
406	0.6
407	0.56
408	0.54
409	0.48
410	0.41
411	0.34
412	0.25
413	0.21
414	0.24
415	0.22
416	0.21
417	0.23
418	0.22
419	0.27
420	0.37
421	0.4
422	0.38
423	0.44
424	0.52
425	0.58
426	0.63
427	0.64
428	0.63
429	0.59
430	0.55
431	0.47
432	0.38
433	0.28
434	0.2
435	0.13
436	0.04
437	0.03
438	0.02
439	0.02
440	0.02
441	0.02
442	0.03
443	0.06
444	0.06
445	0.08
446	0.1
447	0.14
448	0.16
449	0.19
450	0.24
451	0.28
452	0.34
453	0.39
454	0.48
455	0.52
456	0.55
457	0.54
458	0.53
459	0.51
460	0.52
461	0.5
462	0.43
463	0.39
464	0.4
465	0.38
466	0.34
467	0.3
468	0.23
469	0.18
470	0.15
471	0.1
472	0.05
473	0.04
474	0.04
475	0.04
476	0.04
477	0.04
478	0.04
479	0.04
480	0.04
481	0.07
482	0.07
483	0.07
484	0.11
485	0.11
486	0.12
487	0.13
488	0.12
489	0.11
490	0.11
491	0.11
492	0.08
493	0.07
494	0.07
495	0.09
496	0.09
497	0.09
498	0.09
499	0.1
500	0.1
501	0.13
502	0.16
503	0.15
504	0.17
505	0.25
506	0.27
507	0.27
508	0.33
509	0.36
510	0.36
511	0.35
512	0.33
513	0.33
514	0.38
515	0.42
516	0.42
517	0.43
518	0.45
519	0.53
520	0.57
521	0.52
522	0.47
523	0.47
524	0.43
525	0.43
526	0.4
527	0.4
528	0.44
529	0.5
530	0.55

A0A0M9VV78

3D AlphaFold-predicted Structure Viewer