Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M9VVV8

Protein Details
Accession A0A0M9VVV8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
203-228VLMMKSRARSREKRRRLSASPNSSRIHydrophilic
NLS Segment(s)
PositionSequence
208-220SRARSREKRRRLS
Subcellular Location(s) plas 16, extr 6, mito 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGLLNPVYAVFIPFIFGITIPLAIVAGITSTVAFSVLLCRVIVVYLDLIISIVSRSVVGVSLDKSRRTASISSYGYLRRSPPSSFFSPSPSPSSPPSSYFQLPGPSASGGKQAASPAGSPNYLRRHHRHRRGSIGNHAGGAVTPVGETGLGLIPSVGPERDFEGIGGWRSGGDDDEIWTGINSRLELPDKQHARAGTAGDNGVLMMKSRARSREKRRRLSASPNSSRIRAPSGSRFGYATGQASASAGAAGNTGTTAANRGTKRAPSGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.09
5 0.09
6 0.09
7 0.08
8 0.08
9 0.07
10 0.06
11 0.06
12 0.04
13 0.03
14 0.03
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.08
23 0.09
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.08
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.06
45 0.06
46 0.08
47 0.1
48 0.18
49 0.21
50 0.22
51 0.23
52 0.23
53 0.24
54 0.26
55 0.26
56 0.22
57 0.29
58 0.29
59 0.29
60 0.3
61 0.31
62 0.29
63 0.29
64 0.27
65 0.23
66 0.24
67 0.25
68 0.27
69 0.31
70 0.33
71 0.35
72 0.34
73 0.36
74 0.36
75 0.36
76 0.38
77 0.33
78 0.31
79 0.31
80 0.36
81 0.31
82 0.32
83 0.32
84 0.31
85 0.3
86 0.29
87 0.28
88 0.25
89 0.24
90 0.21
91 0.19
92 0.15
93 0.15
94 0.13
95 0.15
96 0.11
97 0.11
98 0.11
99 0.1
100 0.1
101 0.1
102 0.1
103 0.09
104 0.1
105 0.1
106 0.1
107 0.16
108 0.22
109 0.25
110 0.3
111 0.34
112 0.44
113 0.54
114 0.63
115 0.67
116 0.66
117 0.71
118 0.73
119 0.72
120 0.69
121 0.64
122 0.54
123 0.45
124 0.39
125 0.3
126 0.21
127 0.18
128 0.09
129 0.04
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.06
143 0.05
144 0.04
145 0.05
146 0.07
147 0.08
148 0.09
149 0.08
150 0.09
151 0.1
152 0.11
153 0.1
154 0.08
155 0.07
156 0.08
157 0.08
158 0.06
159 0.06
160 0.05
161 0.07
162 0.08
163 0.08
164 0.08
165 0.07
166 0.08
167 0.09
168 0.1
169 0.09
170 0.09
171 0.12
172 0.14
173 0.16
174 0.19
175 0.26
176 0.28
177 0.29
178 0.31
179 0.29
180 0.28
181 0.29
182 0.27
183 0.21
184 0.2
185 0.18
186 0.15
187 0.15
188 0.12
189 0.11
190 0.09
191 0.07
192 0.07
193 0.1
194 0.12
195 0.17
196 0.24
197 0.32
198 0.43
199 0.53
200 0.63
201 0.71
202 0.79
203 0.84
204 0.86
205 0.84
206 0.85
207 0.84
208 0.84
209 0.81
210 0.79
211 0.73
212 0.66
213 0.61
214 0.52
215 0.48
216 0.4
217 0.38
218 0.39
219 0.43
220 0.43
221 0.43
222 0.4
223 0.36
224 0.35
225 0.32
226 0.25
227 0.19
228 0.17
229 0.16
230 0.15
231 0.14
232 0.11
233 0.09
234 0.07
235 0.06
236 0.06
237 0.05
238 0.05
239 0.05
240 0.06
241 0.05
242 0.06
243 0.08
244 0.11
245 0.18
246 0.19
247 0.23
248 0.28
249 0.32