Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9VV08

Protein Details
Accession A0A0M9VV08   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
82-119REQKVRNKFHSQKFHERKGLKRKRLRSERWRARFKVGFBasic
NLS Segment(s)
PositionSequence
92-120SQKFHERKGLKRKRLRSERWRARFKVGFK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MYDPSPAAYNASDPLANFDIAEILSQKAAAYGSSLDIADPLTRPLVRTRPPTGRTVFIADRLSPTTAPTPIVAVRVLERMCREQKVRNKFHSQKFHERKGLKRKRLRSERWRARFKVGFKAAVSKVMELKKQGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.17
4 0.16
5 0.14
6 0.13
7 0.12
8 0.13
9 0.08
10 0.07
11 0.07
12 0.07
13 0.07
14 0.07
15 0.07
16 0.06
17 0.06
18 0.06
19 0.07
20 0.08
21 0.08
22 0.07
23 0.07
24 0.08
25 0.07
26 0.07
27 0.07
28 0.08
29 0.09
30 0.1
31 0.14
32 0.21
33 0.25
34 0.31
35 0.36
36 0.43
37 0.45
38 0.49
39 0.47
40 0.43
41 0.39
42 0.39
43 0.33
44 0.28
45 0.27
46 0.22
47 0.21
48 0.2
49 0.19
50 0.14
51 0.15
52 0.12
53 0.11
54 0.12
55 0.1
56 0.1
57 0.1
58 0.11
59 0.09
60 0.08
61 0.08
62 0.11
63 0.11
64 0.12
65 0.13
66 0.17
67 0.2
68 0.23
69 0.25
70 0.3
71 0.38
72 0.47
73 0.53
74 0.55
75 0.63
76 0.68
77 0.75
78 0.78
79 0.77
80 0.78
81 0.79
82 0.8
83 0.78
84 0.75
85 0.75
86 0.76
87 0.79
88 0.78
89 0.79
90 0.8
91 0.83
92 0.88
93 0.9
94 0.89
95 0.9
96 0.91
97 0.91
98 0.91
99 0.84
100 0.83
101 0.79
102 0.72
103 0.71
104 0.65
105 0.6
106 0.51
107 0.56
108 0.47
109 0.47
110 0.45
111 0.36
112 0.38
113 0.38
114 0.4