Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M8MZW0

Protein Details
Accession A0A0M8MZW0    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
203-231NPNLSTSKNNTNRCRCNSRCNSWKLNYNNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, nucl 10.5, cyto_nucl 9.333, cyto_mito 8.999, cyto 5
Family & Domain DBs
Amino Acid Sequences MRSDSKGAGSRNMLSKPPPGSLRRPPTPEYRADDATGPAADMFVSTVSPASSPEAPRSVAAGLESKTLPSNPGGDYKRDEGFENRLRNGSVNGNGVVRNGSVNGSGVVRNGSVNGNGMVRNGSVNGNGMARNGSFSEHNMIRKASFNEHNVIRKGSFNEHNVVRKGSFNRNGVAATGPPPRRVGSKDLPGIPAQIPGSGSMTNPNLSTSKNNTNRCRCNSRCNSWKLNYNNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.38
4 0.4
5 0.42
6 0.42
7 0.47
8 0.55
9 0.61
10 0.63
11 0.65
12 0.64
13 0.66
14 0.66
15 0.65
16 0.62
17 0.59
18 0.53
19 0.49
20 0.46
21 0.37
22 0.34
23 0.27
24 0.2
25 0.13
26 0.11
27 0.09
28 0.07
29 0.07
30 0.05
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.06
37 0.09
38 0.13
39 0.14
40 0.18
41 0.2
42 0.2
43 0.2
44 0.21
45 0.18
46 0.14
47 0.14
48 0.14
49 0.12
50 0.14
51 0.13
52 0.13
53 0.13
54 0.13
55 0.13
56 0.11
57 0.13
58 0.12
59 0.2
60 0.21
61 0.23
62 0.26
63 0.28
64 0.29
65 0.27
66 0.28
67 0.23
68 0.29
69 0.34
70 0.34
71 0.32
72 0.32
73 0.31
74 0.3
75 0.29
76 0.24
77 0.2
78 0.17
79 0.17
80 0.17
81 0.16
82 0.16
83 0.14
84 0.1
85 0.08
86 0.07
87 0.06
88 0.06
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.07
98 0.07
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.06
107 0.06
108 0.07
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07
114 0.07
115 0.08
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.07
122 0.08
123 0.13
124 0.15
125 0.17
126 0.17
127 0.18
128 0.18
129 0.21
130 0.22
131 0.23
132 0.25
133 0.26
134 0.29
135 0.32
136 0.37
137 0.34
138 0.34
139 0.3
140 0.27
141 0.27
142 0.28
143 0.3
144 0.27
145 0.31
146 0.33
147 0.38
148 0.37
149 0.36
150 0.32
151 0.32
152 0.34
153 0.38
154 0.41
155 0.38
156 0.37
157 0.36
158 0.35
159 0.31
160 0.28
161 0.2
162 0.16
163 0.23
164 0.23
165 0.24
166 0.26
167 0.26
168 0.28
169 0.31
170 0.35
171 0.34
172 0.41
173 0.45
174 0.46
175 0.47
176 0.44
177 0.43
178 0.36
179 0.32
180 0.24
181 0.19
182 0.16
183 0.15
184 0.17
185 0.15
186 0.14
187 0.16
188 0.17
189 0.17
190 0.17
191 0.18
192 0.17
193 0.19
194 0.25
195 0.27
196 0.36
197 0.44
198 0.53
199 0.61
200 0.7
201 0.77
202 0.8
203 0.83
204 0.78
205 0.8
206 0.81
207 0.81
208 0.81
209 0.79
210 0.8
211 0.76
212 0.8