Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M8MTT8

Protein Details
Accession A0A0M8MTT8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-27SSQHNQSRKAHRNGIKKPKTSHydrophilic
NLS Segment(s)
PositionSequence
14-29RKAHRNGIKKPKTSKY
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSRKAHRNGIKKPKTSKYPSLKGCDPKFRRNHRHTLHGMMRALKEFREGKRETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.79
3 0.79
4 0.77
5 0.79
6 0.8
7 0.83
8 0.81
9 0.78
10 0.79
11 0.77
12 0.78
13 0.75
14 0.74
15 0.72
16 0.72
17 0.7
18 0.69
19 0.66
20 0.65
21 0.63
22 0.63
23 0.59
24 0.6
25 0.64
26 0.68
27 0.74
28 0.72
29 0.78
30 0.72
31 0.76
32 0.7
33 0.7
34 0.65
35 0.61
36 0.57
37 0.5
38 0.47
39 0.42
40 0.39
41 0.3
42 0.31
43 0.31
44 0.32
45 0.37