Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9VSZ7

Protein Details
Accession A0A0M9VSZ7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89MVRSSRKKAAKAKAAAKKKAHydrophilic
NLS Segment(s)
PositionSequence
74-89SRKKAAKAKAAAKKKA
Subcellular Location(s) plas 19, E.R. 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLDKLVGLAMLVAASVIFLYYTIWTLLMPFVDDDHPLQNLFLPRVWAIRIPVILLLLGSAVVGSFVGMVMVRSSRKKAAKAKAAAKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.04
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.07
14 0.06
15 0.06
16 0.06
17 0.07
18 0.07
19 0.08
20 0.09
21 0.09
22 0.1
23 0.09
24 0.09
25 0.1
26 0.11
27 0.11
28 0.1
29 0.1
30 0.1
31 0.11
32 0.11
33 0.1
34 0.1
35 0.1
36 0.1
37 0.09
38 0.09
39 0.08
40 0.08
41 0.06
42 0.05
43 0.04
44 0.03
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.03
55 0.03
56 0.04
57 0.07
58 0.1
59 0.13
60 0.17
61 0.25
62 0.3
63 0.38
64 0.47
65 0.55
66 0.62
67 0.68
68 0.75
69 0.77