Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M9VX67

Protein Details
Accession A0A0M9VX67    Localization Confidence High Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
90-117AIAPVPKWGKQSKKKKAAIHTPQARKVGHydrophilic
533-558GKGKGEAGRRERKKGWRRVQDDLDDNBasic
NLS Segment(s)
PositionSequence
96-107KWGKQSKKKKAA
534-550KGKGEAGRRERKKGWRR
Subcellular Location(s) nucl 20, cyto 4, mito 1, pero 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR039128  TRIP4-like  
IPR009349  Znf_C2HC5  
Gene Ontology GO:0005634  C:nucleus  
GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF06221  zf-C2HC5  
Amino Acid Sequences MSLAQLSQLLPLPEEELQQVLDYALTLSKAEAASHFSNLLGDSPLAVDFISSFNSRRRQPQTPAPTPAPATSQPAAAAAAAPAAATTPGAIAPVPKWGKQSKKKKAAIHTPQARKVGDYAGPAGKAYNKKDADLEYMAPQRDSTPSTAAPSRHASRPSTPPKPKPEPVSAPQAKPAQPAPKQNITTAAGYLISDMPKKGKDKSAQNSRSSTPKPAAPSTGNVTKVSISGGVPMAGQSTALADLDLAIRSLEITTNPTLDNVQSRRCNCVATRHPLQAAAPNCLSCGKVVCLREGLGPCTFCGTPILSSGDIQAMIRELKDERGREKMAANAAAHRKPDAAAAAASSRTPRREEDSGGNTNSPSLAEAAARARDHRDKLLNFQANNAKRTTVHDEAADFDVSGAMSGMGSMWATPEERARELKRQQKLMREMEWNARPEYEKRQQIVSIDLSGRRVVKTIGSVQRPASPEEDGGENDEDEQRRGEEEKEEEEAEGKGSNYRIGGGAEAGRTAGGAFSSNPLLGAVMRPVFEAEGKGKGEAGRRERKKGWRRVQDDLDDNEGVILDGGALGRAGGGDEPECG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.14
4 0.14
5 0.14
6 0.13
7 0.1
8 0.09
9 0.08
10 0.08
11 0.08
12 0.08
13 0.08
14 0.07
15 0.11
16 0.11
17 0.12
18 0.12
19 0.18
20 0.19
21 0.2
22 0.21
23 0.17
24 0.18
25 0.18
26 0.18
27 0.13
28 0.11
29 0.1
30 0.1
31 0.1
32 0.09
33 0.09
34 0.07
35 0.06
36 0.07
37 0.1
38 0.11
39 0.13
40 0.2
41 0.28
42 0.32
43 0.41
44 0.48
45 0.53
46 0.59
47 0.68
48 0.71
49 0.72
50 0.76
51 0.7
52 0.66
53 0.6
54 0.54
55 0.49
56 0.4
57 0.38
58 0.31
59 0.29
60 0.25
61 0.23
62 0.22
63 0.16
64 0.15
65 0.08
66 0.07
67 0.06
68 0.06
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.07
79 0.07
80 0.16
81 0.19
82 0.21
83 0.27
84 0.34
85 0.45
86 0.54
87 0.65
88 0.67
89 0.75
90 0.81
91 0.83
92 0.86
93 0.86
94 0.86
95 0.85
96 0.85
97 0.82
98 0.81
99 0.79
100 0.69
101 0.59
102 0.5
103 0.43
104 0.36
105 0.29
106 0.27
107 0.24
108 0.24
109 0.22
110 0.22
111 0.23
112 0.27
113 0.28
114 0.34
115 0.32
116 0.33
117 0.36
118 0.37
119 0.36
120 0.33
121 0.31
122 0.27
123 0.31
124 0.31
125 0.28
126 0.26
127 0.22
128 0.22
129 0.22
130 0.18
131 0.17
132 0.18
133 0.22
134 0.26
135 0.25
136 0.27
137 0.31
138 0.33
139 0.35
140 0.37
141 0.37
142 0.39
143 0.48
144 0.53
145 0.57
146 0.62
147 0.65
148 0.72
149 0.76
150 0.77
151 0.73
152 0.73
153 0.69
154 0.64
155 0.67
156 0.63
157 0.55
158 0.55
159 0.54
160 0.46
161 0.41
162 0.43
163 0.4
164 0.4
165 0.47
166 0.48
167 0.51
168 0.51
169 0.49
170 0.49
171 0.42
172 0.38
173 0.3
174 0.24
175 0.16
176 0.14
177 0.15
178 0.11
179 0.1
180 0.09
181 0.1
182 0.12
183 0.16
184 0.18
185 0.21
186 0.27
187 0.33
188 0.42
189 0.51
190 0.6
191 0.63
192 0.66
193 0.66
194 0.61
195 0.62
196 0.54
197 0.49
198 0.4
199 0.36
200 0.36
201 0.34
202 0.36
203 0.29
204 0.3
205 0.3
206 0.33
207 0.31
208 0.27
209 0.26
210 0.22
211 0.21
212 0.18
213 0.14
214 0.09
215 0.09
216 0.09
217 0.08
218 0.08
219 0.07
220 0.07
221 0.06
222 0.06
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.03
229 0.04
230 0.05
231 0.05
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.07
240 0.08
241 0.09
242 0.09
243 0.09
244 0.1
245 0.1
246 0.15
247 0.15
248 0.2
249 0.25
250 0.26
251 0.3
252 0.3
253 0.32
254 0.27
255 0.34
256 0.35
257 0.36
258 0.4
259 0.37
260 0.37
261 0.35
262 0.35
263 0.31
264 0.26
265 0.22
266 0.18
267 0.16
268 0.16
269 0.16
270 0.16
271 0.1
272 0.1
273 0.08
274 0.12
275 0.13
276 0.13
277 0.13
278 0.14
279 0.17
280 0.16
281 0.17
282 0.14
283 0.14
284 0.13
285 0.15
286 0.14
287 0.11
288 0.11
289 0.1
290 0.09
291 0.1
292 0.12
293 0.1
294 0.1
295 0.11
296 0.1
297 0.09
298 0.08
299 0.07
300 0.06
301 0.06
302 0.06
303 0.06
304 0.06
305 0.11
306 0.15
307 0.17
308 0.19
309 0.24
310 0.25
311 0.25
312 0.26
313 0.24
314 0.23
315 0.24
316 0.22
317 0.23
318 0.27
319 0.27
320 0.26
321 0.24
322 0.22
323 0.18
324 0.19
325 0.14
326 0.1
327 0.08
328 0.09
329 0.09
330 0.09
331 0.09
332 0.1
333 0.12
334 0.13
335 0.15
336 0.16
337 0.21
338 0.23
339 0.26
340 0.31
341 0.35
342 0.38
343 0.37
344 0.36
345 0.3
346 0.27
347 0.24
348 0.17
349 0.11
350 0.07
351 0.06
352 0.05
353 0.07
354 0.09
355 0.12
356 0.12
357 0.12
358 0.17
359 0.22
360 0.24
361 0.28
362 0.33
363 0.31
364 0.37
365 0.46
366 0.47
367 0.41
368 0.45
369 0.48
370 0.45
371 0.46
372 0.41
373 0.32
374 0.27
375 0.33
376 0.35
377 0.3
378 0.27
379 0.25
380 0.25
381 0.27
382 0.28
383 0.23
384 0.15
385 0.11
386 0.1
387 0.09
388 0.08
389 0.06
390 0.04
391 0.03
392 0.03
393 0.03
394 0.03
395 0.03
396 0.03
397 0.03
398 0.04
399 0.05
400 0.06
401 0.1
402 0.13
403 0.15
404 0.22
405 0.25
406 0.34
407 0.41
408 0.49
409 0.52
410 0.59
411 0.61
412 0.65
413 0.7
414 0.67
415 0.64
416 0.6
417 0.57
418 0.56
419 0.57
420 0.5
421 0.42
422 0.38
423 0.35
424 0.33
425 0.39
426 0.4
427 0.41
428 0.4
429 0.42
430 0.43
431 0.41
432 0.43
433 0.35
434 0.3
435 0.26
436 0.25
437 0.24
438 0.25
439 0.25
440 0.2
441 0.19
442 0.16
443 0.15
444 0.18
445 0.25
446 0.31
447 0.33
448 0.35
449 0.36
450 0.41
451 0.41
452 0.39
453 0.32
454 0.26
455 0.23
456 0.22
457 0.22
458 0.17
459 0.19
460 0.18
461 0.15
462 0.15
463 0.19
464 0.19
465 0.17
466 0.18
467 0.15
468 0.16
469 0.18
470 0.19
471 0.19
472 0.21
473 0.24
474 0.26
475 0.26
476 0.24
477 0.23
478 0.22
479 0.17
480 0.15
481 0.12
482 0.12
483 0.13
484 0.14
485 0.13
486 0.14
487 0.14
488 0.13
489 0.13
490 0.12
491 0.14
492 0.12
493 0.12
494 0.11
495 0.1
496 0.09
497 0.08
498 0.07
499 0.05
500 0.06
501 0.06
502 0.09
503 0.1
504 0.1
505 0.1
506 0.1
507 0.1
508 0.1
509 0.1
510 0.12
511 0.12
512 0.13
513 0.13
514 0.14
515 0.14
516 0.15
517 0.17
518 0.15
519 0.19
520 0.2
521 0.2
522 0.21
523 0.24
524 0.3
525 0.36
526 0.43
527 0.48
528 0.54
529 0.62
530 0.69
531 0.76
532 0.8
533 0.82
534 0.83
535 0.83
536 0.83
537 0.84
538 0.85
539 0.82
540 0.79
541 0.72
542 0.66
543 0.55
544 0.49
545 0.39
546 0.3
547 0.22
548 0.15
549 0.1
550 0.04
551 0.05
552 0.05
553 0.05
554 0.04
555 0.04
556 0.04
557 0.04
558 0.05
559 0.05
560 0.07