FuNGI

A0A0M9VX67

Protein Details

Accession

A0A0M9VX67

Localization Confidence

High

Confidence Score

19.4

NoLS Segment(s)

Position	Sequence	Protein Nature
90-117	AIAPVPKWGKQSKKKKAAIHTPQARKVG	Hydrophilic
533-558	GKGKGEAGRRERKKGWRRVQDDLDDN	Basic

NLS Segment(s)

Position	Sequence
96-107	KWGKQSKKKKAA
534-550	KGKGEAGRRERKKGWRR

Subcellular Location(s)

nucl 20, cyto 4, mito 1, pero 1, cysk 1

Family & Domain DBs

InterPro	View protein in InterPro IPR039128 TRIP4-like IPR009349 Znf_C2HC5
Gene Ontology	GO:0005634 C:nucleus GO:0008270 F:zinc ion binding GO:0006355 P:regulation of DNA-templated transcription
Pfam	View protein in Pfam PF06221 zf-C2HC5

Amino Acid Sequences

MSLAQLSQLLPLPEEELQQVLDYALTLSKAEAASHFSNLLGDSPLAVDFISSFNSRRRQPQTPAPTPAPATSQPAAAAAAAPAAATTPGAIAPVPKWGKQSKKKKAAIHTPQARKVGDYAGPAGKAYNKKDADLEYMAPQRDSTPSTAAPSRHASRPSTPPKPKPEPVSAPQAKPAQPAPKQNITTAAGYLISDMPKKGKDKSAQNSRSSTPKPAAPSTGNVTKVSISGGVPMAGQSTALADLDLAIRSLEITTNPTLDNVQSRRCNCVATRHPLQAAAPNCLSCGKVVCLREGLGPCTFCGTPILSSGDIQAMIRELKDERGREKMAANAAAHRKPDAAAAAASSRTPRREEDSGGNTNSPSLAEAAARARDHRDKLLNFQANNAKRTTVHDEAADFDVSGAMSGMGSMWATPEERARELKRQQKLMREMEWNARPEYEKRQQIVSIDLSGRRVVKTIGSVQRPASPEEDGGENDEDEQRRGEEEKEEEEAEGKGSNYRIGGGAEAGRTAGGAFSSNPLLGAVMRPVFEAEGKGKGEAGRRERKKGWRRVQDDLDDNEGVILDGGALGRAGGGDEPECG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.18
2	0.16
3	0.14
4	0.14
5	0.14
6	0.13
7	0.1
8	0.09
9	0.08
10	0.08
11	0.08
12	0.08
13	0.08
14	0.07
15	0.11
16	0.11
17	0.12
18	0.12
19	0.18
20	0.19
21	0.2
22	0.21
23	0.17
24	0.18
25	0.18
26	0.18
27	0.13
28	0.11
29	0.1
30	0.1
31	0.1
32	0.09
33	0.09
34	0.07
35	0.06
36	0.07
37	0.1
38	0.11
39	0.13
40	0.2
41	0.28
42	0.32
43	0.41
44	0.48
45	0.53
46	0.59
47	0.68
48	0.71
49	0.72
50	0.76
51	0.7
52	0.66
53	0.6
54	0.54
55	0.49
56	0.4
57	0.38
58	0.31
59	0.29
60	0.25
61	0.23
62	0.22
63	0.16
64	0.15
65	0.08
66	0.07
67	0.06
68	0.06
69	0.04
70	0.04
71	0.04
72	0.04
73	0.04
74	0.04
75	0.04
76	0.05
77	0.05
78	0.07
79	0.07
80	0.16
81	0.19
82	0.21
83	0.27
84	0.34
85	0.45
86	0.54
87	0.65
88	0.67
89	0.75
90	0.81
91	0.83
92	0.86
93	0.86
94	0.86
95	0.85
96	0.85
97	0.82
98	0.81
99	0.79
100	0.69
101	0.59
102	0.5
103	0.43
104	0.36
105	0.29
106	0.27
107	0.24
108	0.24
109	0.22
110	0.22
111	0.23
112	0.27
113	0.28
114	0.34
115	0.32
116	0.33
117	0.36
118	0.37
119	0.36
120	0.33
121	0.31
122	0.27
123	0.31
124	0.31
125	0.28
126	0.26
127	0.22
128	0.22
129	0.22
130	0.18
131	0.17
132	0.18
133	0.22
134	0.26
135	0.25
136	0.27
137	0.31
138	0.33
139	0.35
140	0.37
141	0.37
142	0.39
143	0.48
144	0.53
145	0.57
146	0.62
147	0.65
148	0.72
149	0.76
150	0.77
151	0.73
152	0.73
153	0.69
154	0.64
155	0.67
156	0.63
157	0.55
158	0.55
159	0.54
160	0.46
161	0.41
162	0.43
163	0.4
164	0.4
165	0.47
166	0.48
167	0.51
168	0.51
169	0.49
170	0.49
171	0.42
172	0.38
173	0.3
174	0.24
175	0.16
176	0.14
177	0.15
178	0.11
179	0.1
180	0.09
181	0.1
182	0.12
183	0.16
184	0.18
185	0.21
186	0.27
187	0.33
188	0.42
189	0.51
190	0.6
191	0.63
192	0.66
193	0.66
194	0.61
195	0.62
196	0.54
197	0.49
198	0.4
199	0.36
200	0.36
201	0.34
202	0.36
203	0.29
204	0.3
205	0.3
206	0.33
207	0.31
208	0.27
209	0.26
210	0.22
211	0.21
212	0.18
213	0.14
214	0.09
215	0.09
216	0.09
217	0.08
218	0.08
219	0.07
220	0.07
221	0.06
222	0.06
223	0.04
224	0.04
225	0.04
226	0.04
227	0.04
228	0.03
229	0.04
230	0.05
231	0.05
232	0.04
233	0.04
234	0.04
235	0.04
236	0.04
237	0.04
238	0.04
239	0.07
240	0.08
241	0.09
242	0.09
243	0.09
244	0.1
245	0.1
246	0.15
247	0.15
248	0.2
249	0.25
250	0.26
251	0.3
252	0.3
253	0.32
254	0.27
255	0.34
256	0.35
257	0.36
258	0.4
259	0.37
260	0.37
261	0.35
262	0.35
263	0.31
264	0.26
265	0.22
266	0.18
267	0.16
268	0.16
269	0.16
270	0.16
271	0.1
272	0.1
273	0.08
274	0.12
275	0.13
276	0.13
277	0.13
278	0.14
279	0.17
280	0.16
281	0.17
282	0.14
283	0.14
284	0.13
285	0.15
286	0.14
287	0.11
288	0.11
289	0.1
290	0.09
291	0.1
292	0.12
293	0.1
294	0.1
295	0.11
296	0.1
297	0.09
298	0.08
299	0.07
300	0.06
301	0.06
302	0.06
303	0.06
304	0.06
305	0.11
306	0.15
307	0.17
308	0.19
309	0.24
310	0.25
311	0.25
312	0.26
313	0.24
314	0.23
315	0.24
316	0.22
317	0.23
318	0.27
319	0.27
320	0.26
321	0.24
322	0.22
323	0.18
324	0.19
325	0.14
326	0.1
327	0.08
328	0.09
329	0.09
330	0.09
331	0.09
332	0.1
333	0.12
334	0.13
335	0.15
336	0.16
337	0.21
338	0.23
339	0.26
340	0.31
341	0.35
342	0.38
343	0.37
344	0.36
345	0.3
346	0.27
347	0.24
348	0.17
349	0.11
350	0.07
351	0.06
352	0.05
353	0.07
354	0.09
355	0.12
356	0.12
357	0.12
358	0.17
359	0.22
360	0.24
361	0.28
362	0.33
363	0.31
364	0.37
365	0.46
366	0.47
367	0.41
368	0.45
369	0.48
370	0.45
371	0.46
372	0.41
373	0.32
374	0.27
375	0.33
376	0.35
377	0.3
378	0.27
379	0.25
380	0.25
381	0.27
382	0.28
383	0.23
384	0.15
385	0.11
386	0.1
387	0.09
388	0.08
389	0.06
390	0.04
391	0.03
392	0.03
393	0.03
394	0.03
395	0.03
396	0.03
397	0.03
398	0.04
399	0.05
400	0.06
401	0.1
402	0.13
403	0.15
404	0.22
405	0.25
406	0.34
407	0.41
408	0.49
409	0.52
410	0.59
411	0.61
412	0.65
413	0.7
414	0.67
415	0.64
416	0.6
417	0.57
418	0.56
419	0.57
420	0.5
421	0.42
422	0.38
423	0.35
424	0.33
425	0.39
426	0.4
427	0.41
428	0.4
429	0.42
430	0.43
431	0.41
432	0.43
433	0.35
434	0.3
435	0.26
436	0.25
437	0.24
438	0.25
439	0.25
440	0.2
441	0.19
442	0.16
443	0.15
444	0.18
445	0.25
446	0.31
447	0.33
448	0.35
449	0.36
450	0.41
451	0.41
452	0.39
453	0.32
454	0.26
455	0.23
456	0.22
457	0.22
458	0.17
459	0.19
460	0.18
461	0.15
462	0.15
463	0.19
464	0.19
465	0.17
466	0.18
467	0.15
468	0.16
469	0.18
470	0.19
471	0.19
472	0.21
473	0.24
474	0.26
475	0.26
476	0.24
477	0.23
478	0.22
479	0.17
480	0.15
481	0.12
482	0.12
483	0.13
484	0.14
485	0.13
486	0.14
487	0.14
488	0.13
489	0.13
490	0.12
491	0.14
492	0.12
493	0.12
494	0.11
495	0.1
496	0.09
497	0.08
498	0.07
499	0.05
500	0.06
501	0.06
502	0.09
503	0.1
504	0.1
505	0.1
506	0.1
507	0.1
508	0.1
509	0.1
510	0.12
511	0.12
512	0.13
513	0.13
514	0.14
515	0.14
516	0.15
517	0.17
518	0.15
519	0.19
520	0.2
521	0.2
522	0.21
523	0.24
524	0.3
525	0.36
526	0.43
527	0.48
528	0.54
529	0.62
530	0.69
531	0.76
532	0.8
533	0.82
534	0.83
535	0.83
536	0.83
537	0.84
538	0.85
539	0.82
540	0.79
541	0.72
542	0.66
543	0.55
544	0.49
545	0.39
546	0.3
547	0.22
548	0.15
549	0.1
550	0.04
551	0.05
552	0.05
553	0.05
554	0.04
555	0.04
556	0.04
557	0.04
558	0.05
559	0.05
560	0.07

A0A0M9VX67

3D AlphaFold-predicted Structure Viewer