Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M9VVL9

Protein Details
Accession A0A0M9VVL9    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MASHRVTYRRRNGYNTRSNRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MASHRVTYRRRNGYNTRSNRTRVIKTPGGDLRVLHIKKRGTAPKCGDCGDKLPGIPALRPREYAQISKPQKTVQRAYGGSRCGNCVRDRIVRAFLIEEQKIVKKVLKEQEQSQKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.79
4 0.75
5 0.73
6 0.73
7 0.7
8 0.66
9 0.62
10 0.61
11 0.58
12 0.52
13 0.57
14 0.52
15 0.48
16 0.42
17 0.35
18 0.31
19 0.35
20 0.34
21 0.29
22 0.3
23 0.28
24 0.31
25 0.39
26 0.44
27 0.38
28 0.46
29 0.51
30 0.52
31 0.53
32 0.51
33 0.44
34 0.37
35 0.37
36 0.31
37 0.24
38 0.18
39 0.16
40 0.17
41 0.16
42 0.16
43 0.19
44 0.22
45 0.22
46 0.24
47 0.24
48 0.28
49 0.29
50 0.3
51 0.27
52 0.32
53 0.36
54 0.38
55 0.38
56 0.36
57 0.4
58 0.43
59 0.44
60 0.39
61 0.42
62 0.4
63 0.44
64 0.44
65 0.41
66 0.39
67 0.35
68 0.34
69 0.3
70 0.31
71 0.28
72 0.27
73 0.29
74 0.33
75 0.35
76 0.35
77 0.36
78 0.34
79 0.33
80 0.32
81 0.31
82 0.3
83 0.27
84 0.24
85 0.24
86 0.27
87 0.28
88 0.27
89 0.27
90 0.24
91 0.33
92 0.41
93 0.48
94 0.49
95 0.56
96 0.65