Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M8MYJ9

Protein Details
Accession A0A0M8MYJ9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
92-129HTRLVQKRRHGWLKRMRSKTGRRILERRKLKGRRHVAWBasic
NLS Segment(s)
PositionSequence
98-126KRRHGWLKRMRSKTGRRILERRKLKGRRH
Subcellular Location(s) mito 20.5, cyto_mito 11.5, plas 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MSFLARLARPVVALHIQPSTRTFTTLQPLRPTLLATFRPALTSFAPATPSTAAPGAGERAADLVPAAAVSAHPALAGATQIRFGPRNTMQGHTRLVQKRRHGWLKRMRSKTGRRILERRKLKGRRHVAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.21
4 0.22
5 0.23
6 0.25
7 0.22
8 0.24
9 0.24
10 0.24
11 0.33
12 0.37
13 0.39
14 0.38
15 0.39
16 0.38
17 0.37
18 0.34
19 0.27
20 0.27
21 0.25
22 0.23
23 0.23
24 0.22
25 0.23
26 0.22
27 0.22
28 0.17
29 0.18
30 0.16
31 0.14
32 0.16
33 0.15
34 0.16
35 0.14
36 0.13
37 0.11
38 0.11
39 0.1
40 0.08
41 0.09
42 0.08
43 0.07
44 0.07
45 0.05
46 0.06
47 0.06
48 0.05
49 0.05
50 0.03
51 0.03
52 0.03
53 0.03
54 0.02
55 0.02
56 0.03
57 0.04
58 0.04
59 0.03
60 0.04
61 0.04
62 0.04
63 0.05
64 0.04
65 0.04
66 0.05
67 0.06
68 0.08
69 0.09
70 0.09
71 0.16
72 0.17
73 0.24
74 0.26
75 0.29
76 0.3
77 0.32
78 0.35
79 0.31
80 0.38
81 0.38
82 0.43
83 0.46
84 0.52
85 0.57
86 0.64
87 0.71
88 0.69
89 0.71
90 0.75
91 0.8
92 0.82
93 0.8
94 0.79
95 0.79
96 0.83
97 0.83
98 0.83
99 0.81
100 0.79
101 0.83
102 0.85
103 0.86
104 0.85
105 0.84
106 0.85
107 0.85
108 0.86
109 0.86