Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M8MXL9

Protein Details
Accession A0A0M8MXL9    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
23-53FVAHKKASGKERREERHRRRKEESRDPTLKABasic
NLS Segment(s)
PositionSequence
25-47AHKKASGKERREERHRRRKEESR
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
IPR044281  IMP4/RPF1  
Gene Ontology GO:0042134  F:rRNA primary transcript binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04427  Brix  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MGFTKPPVQALKASNKLKRQELFVAHKKASGKERREERHRRRKEESRDPTLKATRLSKNITRTLDQKRVWDDVDDDSLGAVVDLEKLKRRRIEQAEAEERAALEAAQAENENDDDDDDSMLGSDSEVDEEKRQAALEKQREKRARREPSIAPSTTSTNLDLTPSSLALKFPSLFSDDAAPPPEPKILVTTSLNSTLHDEAEILCTLFPNSHYIPRSSHRYGHKYSLRDICKFSANKEYTAVVLLKEDLKKPTGLSIVHLPAGPTFHFSISNWIEGKKLPGHGNPTNHYPELLLNNFKTPLGLLTAKLFMTMFPPRPEFQGRQVVTLHNQRDYIFVRRHRYVFRDKRQTEKSIAGADGKEMKGVESIRAGLQELGPRFTLKLRRVDKGIGRAGSEGDDATQWEWKSKMEKDRKRFNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.65
3 0.69
4 0.71
5 0.66
6 0.63
7 0.61
8 0.62
9 0.65
10 0.67
11 0.68
12 0.61
13 0.62
14 0.59
15 0.56
16 0.58
17 0.58
18 0.55
19 0.57
20 0.67
21 0.72
22 0.8
23 0.85
24 0.86
25 0.87
26 0.91
27 0.9
28 0.89
29 0.9
30 0.9
31 0.9
32 0.88
33 0.87
34 0.84
35 0.78
36 0.77
37 0.74
38 0.66
39 0.61
40 0.59
41 0.56
42 0.56
43 0.6
44 0.57
45 0.58
46 0.62
47 0.61
48 0.57
49 0.57
50 0.59
51 0.62
52 0.58
53 0.57
54 0.54
55 0.53
56 0.5
57 0.44
58 0.37
59 0.31
60 0.31
61 0.25
62 0.2
63 0.16
64 0.15
65 0.13
66 0.1
67 0.07
68 0.04
69 0.07
70 0.08
71 0.1
72 0.18
73 0.21
74 0.28
75 0.33
76 0.36
77 0.44
78 0.5
79 0.57
80 0.58
81 0.65
82 0.66
83 0.62
84 0.6
85 0.5
86 0.42
87 0.33
88 0.25
89 0.14
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.08
97 0.08
98 0.08
99 0.06
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.06
107 0.06
108 0.05
109 0.04
110 0.04
111 0.04
112 0.05
113 0.06
114 0.07
115 0.09
116 0.1
117 0.11
118 0.11
119 0.11
120 0.11
121 0.17
122 0.25
123 0.33
124 0.42
125 0.47
126 0.57
127 0.65
128 0.67
129 0.71
130 0.72
131 0.73
132 0.69
133 0.7
134 0.65
135 0.66
136 0.68
137 0.59
138 0.5
139 0.42
140 0.38
141 0.33
142 0.3
143 0.22
144 0.16
145 0.15
146 0.14
147 0.13
148 0.11
149 0.1
150 0.09
151 0.09
152 0.09
153 0.09
154 0.08
155 0.1
156 0.1
157 0.09
158 0.1
159 0.11
160 0.11
161 0.11
162 0.14
163 0.13
164 0.14
165 0.16
166 0.15
167 0.13
168 0.14
169 0.14
170 0.11
171 0.1
172 0.12
173 0.1
174 0.13
175 0.13
176 0.14
177 0.14
178 0.18
179 0.17
180 0.15
181 0.17
182 0.14
183 0.14
184 0.12
185 0.11
186 0.08
187 0.09
188 0.09
189 0.07
190 0.06
191 0.06
192 0.06
193 0.06
194 0.06
195 0.08
196 0.09
197 0.14
198 0.15
199 0.17
200 0.2
201 0.23
202 0.31
203 0.29
204 0.34
205 0.37
206 0.42
207 0.44
208 0.5
209 0.51
210 0.46
211 0.49
212 0.51
213 0.48
214 0.44
215 0.44
216 0.37
217 0.38
218 0.37
219 0.33
220 0.35
221 0.32
222 0.3
223 0.3
224 0.28
225 0.21
226 0.23
227 0.21
228 0.11
229 0.1
230 0.1
231 0.12
232 0.13
233 0.15
234 0.15
235 0.15
236 0.16
237 0.16
238 0.18
239 0.18
240 0.16
241 0.16
242 0.2
243 0.2
244 0.2
245 0.2
246 0.17
247 0.14
248 0.16
249 0.14
250 0.11
251 0.11
252 0.11
253 0.11
254 0.11
255 0.19
256 0.19
257 0.22
258 0.2
259 0.2
260 0.2
261 0.19
262 0.23
263 0.18
264 0.21
265 0.21
266 0.23
267 0.31
268 0.35
269 0.4
270 0.39
271 0.42
272 0.42
273 0.38
274 0.35
275 0.29
276 0.26
277 0.26
278 0.26
279 0.25
280 0.21
281 0.23
282 0.23
283 0.22
284 0.2
285 0.14
286 0.12
287 0.13
288 0.13
289 0.12
290 0.13
291 0.15
292 0.15
293 0.15
294 0.14
295 0.1
296 0.13
297 0.18
298 0.2
299 0.22
300 0.26
301 0.26
302 0.31
303 0.37
304 0.36
305 0.37
306 0.43
307 0.4
308 0.4
309 0.41
310 0.39
311 0.39
312 0.44
313 0.4
314 0.32
315 0.32
316 0.3
317 0.33
318 0.34
319 0.36
320 0.35
321 0.4
322 0.45
323 0.49
324 0.53
325 0.54
326 0.58
327 0.61
328 0.64
329 0.68
330 0.72
331 0.69
332 0.75
333 0.76
334 0.75
335 0.68
336 0.62
337 0.56
338 0.48
339 0.47
340 0.4
341 0.33
342 0.31
343 0.32
344 0.27
345 0.25
346 0.2
347 0.19
348 0.2
349 0.21
350 0.2
351 0.16
352 0.17
353 0.17
354 0.17
355 0.18
356 0.15
357 0.17
358 0.21
359 0.2
360 0.21
361 0.21
362 0.21
363 0.21
364 0.27
365 0.33
366 0.32
367 0.41
368 0.44
369 0.49
370 0.52
371 0.59
372 0.6
373 0.6
374 0.62
375 0.54
376 0.5
377 0.46
378 0.42
379 0.36
380 0.3
381 0.21
382 0.14
383 0.13
384 0.13
385 0.13
386 0.17
387 0.16
388 0.18
389 0.19
390 0.22
391 0.29
392 0.35
393 0.45
394 0.51
395 0.61
396 0.68