Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M8N863

Protein Details
Accession A0A0M8N863   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
194-219VNDYFWRLRRRSRRRARRWPSVAQSHHydrophilic
NLS Segment(s)
PositionSequence
201-211LRRRSRRRARR
Subcellular Location(s) nucl 14, cyto 7, plas 3, mito 2
Family & Domain DBs
Amino Acid Sequences MEEPMMDRRLVRYTMADQEPLIPSRCPIDNLSIDVLLLILESLRTAEDIIDFAIAYPPAYATYRRHGHTVMQNIAKSLIPRRNRPVALSCLFITRYPACAQDVLSVFKKLHANPPRDLSFLDVASLWSLVRLASRVNDLAEFYLYAGHSPISHDKFWLKFYKVGHVVPIGGPDEGGSHASPILFDPRRPKFAPVNDYFWRLRRRSRRRARRWPSVAQSHAENMIYQLEMRSRYLWLLSHGHLLPYELGGANLPRGTFRFVGFIESVFFHLIERRAKKASTPETGKLARLECQSWTRARCCLGVKLWACLLSSAETDLSPRLGRALWMQMTKLSNDRRLCARIPQWHWEMRDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.36
4 0.31
5 0.34
6 0.36
7 0.34
8 0.32
9 0.23
10 0.21
11 0.24
12 0.26
13 0.24
14 0.23
15 0.28
16 0.28
17 0.3
18 0.32
19 0.28
20 0.25
21 0.22
22 0.19
23 0.12
24 0.09
25 0.06
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.06
35 0.07
36 0.07
37 0.07
38 0.07
39 0.07
40 0.09
41 0.08
42 0.08
43 0.08
44 0.07
45 0.09
46 0.11
47 0.14
48 0.16
49 0.25
50 0.31
51 0.32
52 0.35
53 0.34
54 0.4
55 0.44
56 0.48
57 0.46
58 0.45
59 0.44
60 0.41
61 0.41
62 0.35
63 0.3
64 0.3
65 0.31
66 0.32
67 0.39
68 0.45
69 0.53
70 0.53
71 0.55
72 0.54
73 0.54
74 0.49
75 0.45
76 0.38
77 0.33
78 0.32
79 0.28
80 0.27
81 0.2
82 0.21
83 0.19
84 0.2
85 0.18
86 0.18
87 0.19
88 0.19
89 0.2
90 0.21
91 0.22
92 0.22
93 0.2
94 0.24
95 0.27
96 0.23
97 0.31
98 0.35
99 0.38
100 0.4
101 0.46
102 0.44
103 0.41
104 0.4
105 0.33
106 0.28
107 0.23
108 0.2
109 0.14
110 0.12
111 0.11
112 0.11
113 0.07
114 0.05
115 0.05
116 0.04
117 0.05
118 0.05
119 0.05
120 0.06
121 0.08
122 0.09
123 0.1
124 0.1
125 0.1
126 0.1
127 0.09
128 0.08
129 0.06
130 0.07
131 0.07
132 0.07
133 0.06
134 0.06
135 0.06
136 0.08
137 0.14
138 0.16
139 0.16
140 0.17
141 0.2
142 0.22
143 0.25
144 0.29
145 0.25
146 0.25
147 0.25
148 0.32
149 0.32
150 0.31
151 0.28
152 0.23
153 0.22
154 0.18
155 0.19
156 0.12
157 0.09
158 0.08
159 0.07
160 0.07
161 0.06
162 0.07
163 0.06
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.12
170 0.12
171 0.14
172 0.22
173 0.25
174 0.31
175 0.32
176 0.35
177 0.35
178 0.41
179 0.48
180 0.43
181 0.47
182 0.43
183 0.47
184 0.44
185 0.43
186 0.44
187 0.37
188 0.43
189 0.47
190 0.56
191 0.62
192 0.73
193 0.78
194 0.82
195 0.91
196 0.91
197 0.91
198 0.88
199 0.85
200 0.81
201 0.77
202 0.69
203 0.59
204 0.51
205 0.42
206 0.36
207 0.28
208 0.2
209 0.13
210 0.11
211 0.1
212 0.08
213 0.08
214 0.09
215 0.1
216 0.11
217 0.11
218 0.11
219 0.12
220 0.13
221 0.12
222 0.14
223 0.16
224 0.16
225 0.2
226 0.2
227 0.2
228 0.19
229 0.19
230 0.15
231 0.12
232 0.12
233 0.07
234 0.07
235 0.07
236 0.07
237 0.07
238 0.08
239 0.08
240 0.08
241 0.09
242 0.12
243 0.13
244 0.13
245 0.16
246 0.15
247 0.19
248 0.18
249 0.17
250 0.15
251 0.15
252 0.16
253 0.13
254 0.12
255 0.09
256 0.12
257 0.16
258 0.23
259 0.26
260 0.29
261 0.31
262 0.32
263 0.35
264 0.42
265 0.45
266 0.46
267 0.49
268 0.48
269 0.53
270 0.54
271 0.52
272 0.46
273 0.4
274 0.36
275 0.33
276 0.31
277 0.28
278 0.3
279 0.32
280 0.35
281 0.39
282 0.36
283 0.37
284 0.38
285 0.39
286 0.39
287 0.4
288 0.37
289 0.41
290 0.39
291 0.38
292 0.37
293 0.34
294 0.31
295 0.25
296 0.24
297 0.17
298 0.16
299 0.15
300 0.13
301 0.12
302 0.13
303 0.13
304 0.14
305 0.13
306 0.12
307 0.12
308 0.12
309 0.14
310 0.16
311 0.23
312 0.26
313 0.27
314 0.28
315 0.31
316 0.33
317 0.34
318 0.38
319 0.37
320 0.4
321 0.42
322 0.45
323 0.47
324 0.5
325 0.5
326 0.51
327 0.53
328 0.55
329 0.58
330 0.62
331 0.62
332 0.63
333 0.63