Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M8MTZ1

Protein Details
Accession A0A0M8MTZ1    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-30LSPSSNEKHPKGKRKRTATKDKLILEHydrophilic
NLS Segment(s)
PositionSequence
12-21KHPKGKRKRT
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00046  Homeodomain  
Amino Acid Sequences MPAPLSPSSNEKHPKGKRKRTATKDKLILEEAYSINPKPDKQARLEIVNRVSLNEKEVQSQCHNLPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.78
4 0.79
5 0.83
6 0.89
7 0.89
8 0.92
9 0.9
10 0.88
11 0.84
12 0.76
13 0.68
14 0.59
15 0.49
16 0.38
17 0.32
18 0.23
19 0.17
20 0.15
21 0.13
22 0.12
23 0.13
24 0.12
25 0.16
26 0.22
27 0.24
28 0.27
29 0.35
30 0.37
31 0.43
32 0.46
33 0.45
34 0.41
35 0.42
36 0.38
37 0.32
38 0.32
39 0.25
40 0.26
41 0.26
42 0.25
43 0.27
44 0.29
45 0.33
46 0.34
47 0.39