Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0M8N504

Protein Details
Accession A0A0M8N504   
Localization Confidence High
Confidence Score 16.6
NoLS Segment(s)
PositionSequenceProtein Nature
111-134QNIPHIIREKRREKRTQKLRLMISHydrophilic
NLS Segment(s)
PositionSequence
51-54RRRR
79-84SRPGRG
119-125EKRREKR
Subcellular Location(s) nucl 18.5, cyto_nucl 15, cyto 6.5
Family & Domain DBs
Amino Acid Sequences GGNNRNLKPPEEKAKEEQKPQHELAPGALRVQSRHAVPAPRAADASLRPLRRRRSADSFTRSTRAPLTKQAPALRAPSSRPGRGIWRSKSADAEAGVKRRFSIGGTLGGIQNIPHIIREKRREKRTQKLRLMISGPRDVRDGVGEVIQRGRAHQQPIAATHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.7
3 0.72
4 0.72
5 0.68
6 0.68
7 0.65
8 0.62
9 0.54
10 0.47
11 0.43
12 0.41
13 0.34
14 0.28
15 0.29
16 0.25
17 0.23
18 0.26
19 0.25
20 0.19
21 0.23
22 0.25
23 0.27
24 0.27
25 0.35
26 0.32
27 0.29
28 0.29
29 0.25
30 0.24
31 0.2
32 0.27
33 0.25
34 0.27
35 0.31
36 0.38
37 0.44
38 0.51
39 0.55
40 0.54
41 0.58
42 0.61
43 0.65
44 0.66
45 0.64
46 0.58
47 0.55
48 0.48
49 0.4
50 0.39
51 0.33
52 0.29
53 0.31
54 0.32
55 0.33
56 0.37
57 0.38
58 0.35
59 0.33
60 0.33
61 0.28
62 0.25
63 0.23
64 0.28
65 0.29
66 0.28
67 0.27
68 0.26
69 0.3
70 0.36
71 0.42
72 0.37
73 0.41
74 0.42
75 0.42
76 0.42
77 0.36
78 0.31
79 0.24
80 0.26
81 0.21
82 0.25
83 0.24
84 0.22
85 0.22
86 0.2
87 0.2
88 0.15
89 0.16
90 0.12
91 0.14
92 0.15
93 0.16
94 0.15
95 0.15
96 0.14
97 0.1
98 0.09
99 0.07
100 0.07
101 0.07
102 0.12
103 0.16
104 0.24
105 0.34
106 0.44
107 0.52
108 0.62
109 0.71
110 0.76
111 0.82
112 0.85
113 0.87
114 0.85
115 0.84
116 0.79
117 0.74
118 0.69
119 0.63
120 0.57
121 0.55
122 0.47
123 0.4
124 0.38
125 0.32
126 0.29
127 0.26
128 0.23
129 0.15
130 0.18
131 0.17
132 0.17
133 0.19
134 0.22
135 0.2
136 0.2
137 0.25
138 0.27
139 0.3
140 0.31
141 0.33
142 0.33