Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0N0RTU2

Protein Details
Accession A0A0N0RTU2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-29SAKKHVPIVKKRTTRFNRHQSDRFKCLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 12.333, cyto_nucl 3.833, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTTRFNRHQSDRFKCLDSSWRKPKGIDSRVRRRFRGTAPMPSIGYGSNKKTRFMMPSGHKAFLVNNVKDLELLMMHNRTHAAEIASAVSSRKRIAIITRAKQLGVKVTNAKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.8
3 0.81
4 0.81
5 0.82
6 0.82
7 0.82
8 0.86
9 0.86
10 0.84
11 0.8
12 0.72
13 0.64
14 0.55
15 0.48
16 0.5
17 0.48
18 0.5
19 0.54
20 0.58
21 0.56
22 0.56
23 0.62
24 0.63
25 0.64
26 0.63
27 0.63
28 0.67
29 0.76
30 0.8
31 0.73
32 0.68
33 0.64
34 0.59
35 0.6
36 0.53
37 0.51
38 0.5
39 0.5
40 0.45
41 0.39
42 0.35
43 0.25
44 0.25
45 0.18
46 0.19
47 0.24
48 0.25
49 0.25
50 0.26
51 0.28
52 0.27
53 0.26
54 0.3
55 0.28
56 0.37
57 0.39
58 0.38
59 0.36
60 0.33
61 0.31
62 0.32
63 0.35
64 0.25
65 0.25
66 0.25
67 0.25
68 0.24
69 0.24
70 0.15
71 0.08
72 0.09
73 0.09
74 0.1
75 0.1
76 0.11
77 0.11
78 0.11
79 0.12
80 0.12
81 0.11
82 0.09
83 0.1
84 0.1
85 0.1
86 0.1
87 0.1
88 0.11
89 0.11
90 0.11
91 0.12
92 0.12
93 0.13
94 0.19
95 0.27
96 0.36
97 0.4
98 0.47
99 0.47
100 0.47
101 0.47
102 0.43
103 0.43
104 0.35
105 0.35
106 0.33
107 0.38
108 0.44
109 0.43
110 0.43
111 0.37