Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0M8N683

Protein Details
Accession A0A0M8N683    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
24-46QEKPKVPKGRAHNRIKHCRRFINBasic
NLS Segment(s)
PositionSequence
23-38PQEKPKVPKGRAHNRI
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEPQEKPKVPKGRAHNRIKHCRRFINVQMTGGKRKMNSNTTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.46
5 0.48
6 0.57
7 0.59
8 0.64
9 0.61
10 0.62
11 0.66
12 0.64
13 0.65
14 0.63
15 0.64
16 0.57
17 0.6
18 0.61
19 0.61
20 0.67
21 0.71
22 0.72
23 0.73
24 0.81
25 0.84
26 0.84
27 0.81
28 0.77
29 0.72
30 0.71
31 0.7
32 0.69
33 0.62
34 0.57
35 0.57
36 0.54
37 0.55
38 0.5
39 0.45
40 0.36
41 0.4
42 0.44