Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VL31

Protein Details
Accession A0A0C9VL31    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
94-113VWLQRIRKPQHNAKLCRPAYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, cyto_nucl 10.5, nucl 7, mito 4, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001236  Lactate/malate_DH_N  
IPR036291  NAD(P)-bd_dom_sf  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF00056  Ldh_1_N  
Amino Acid Sequences MDMPPTSSMRLEGVEVVVIPAGVPRKPVMTHDDLFNTNASIVWDLASAIGRVAPNAHVLVISNPVNSTVPIVASTLAKDHNNRLDNLLSRTMHVWLQRIRKPQHNAKLCRPAYIRNPRRGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.08
5 0.07
6 0.06
7 0.07
8 0.08
9 0.08
10 0.1
11 0.1
12 0.13
13 0.14
14 0.17
15 0.21
16 0.26
17 0.27
18 0.28
19 0.31
20 0.29
21 0.3
22 0.27
23 0.21
24 0.14
25 0.13
26 0.11
27 0.09
28 0.07
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.04
36 0.06
37 0.05
38 0.05
39 0.06
40 0.06
41 0.07
42 0.07
43 0.07
44 0.05
45 0.06
46 0.06
47 0.09
48 0.09
49 0.08
50 0.08
51 0.09
52 0.09
53 0.09
54 0.09
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.09
64 0.11
65 0.12
66 0.16
67 0.23
68 0.25
69 0.26
70 0.28
71 0.29
72 0.3
73 0.32
74 0.33
75 0.26
76 0.25
77 0.25
78 0.24
79 0.23
80 0.22
81 0.24
82 0.25
83 0.34
84 0.38
85 0.46
86 0.5
87 0.57
88 0.64
89 0.68
90 0.72
91 0.74
92 0.76
93 0.76
94 0.82
95 0.73
96 0.72
97 0.65
98 0.63
99 0.63
100 0.67
101 0.67