Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VX63

Protein Details
Accession A0A0C9VX63    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-78EPVPTTYPVPKRPRRPVQGYEDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, plas 5, E.R. 5, extr 3, cyto 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039961  Nuo9.5  
Gene Ontology GO:0016020  C:membrane  
CDD cd22903  NI9M  
Amino Acid Sequences MASIVSPFRRGYRYLQYLAHEQPVIFFACAMGITGPVLALSVPSIRQKYFGYIPAEPVPTTYPVPKRPRRPVQGYEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.43
4 0.46
5 0.46
6 0.42
7 0.33
8 0.26
9 0.23
10 0.21
11 0.19
12 0.13
13 0.11
14 0.07
15 0.07
16 0.07
17 0.07
18 0.05
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.02
27 0.03
28 0.03
29 0.05
30 0.08
31 0.1
32 0.1
33 0.13
34 0.13
35 0.17
36 0.19
37 0.24
38 0.25
39 0.25
40 0.28
41 0.29
42 0.3
43 0.26
44 0.25
45 0.21
46 0.19
47 0.21
48 0.24
49 0.27
50 0.35
51 0.45
52 0.53
53 0.62
54 0.7
55 0.79
56 0.82
57 0.84
58 0.84