Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VGD9

Protein Details
Accession A0A0C9VGD9    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
80-105GSKVYTDAEKRERRRRWRECLYESLPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8.5, extr 8, mito 6, cyto_nucl 5.5, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR000741  FBA_I  
Gene Ontology GO:0004332  F:fructose-bisphosphate aldolase activity  
GO:0006096  P:glycolytic process  
Pfam View protein in Pfam  
PF00274  Glycolytic  
Amino Acid Sequences MSLNATSTPGYTFAASGGAAASDSDPVSYLYPHHSAAVAKSLIATAQALVNPRGKGIYATDETTDGIEARLVAAHGAEGGSKVYTDAEKRERRRRWRECLYESLPTDYISGVILYHETLIDFQLAPVLSNRGIIPGVRADTDAHPLPISPLEPATQGLDDLLPRLQAAYQAGARFSKWRAPILCNSSTLPTQAGLEVQAESLARFAAISQQAGLVPIVEPDVDFAEDADLKKSVEVHVKIISLIYARCAAYGVLLEGSLIKPSFAQPGLKHPSRASTTVEEIGLATATVLARSVPIAVAGIVFLSGGLSDSDAVKYLNAVNAVVNKAPAGSPLALSRLPNMTFSFGRGLQGDAMQKWVRGDEAGAKQAFEARAKACWLAAKGET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.08
5 0.07
6 0.06
7 0.07
8 0.07
9 0.07
10 0.07
11 0.07
12 0.08
13 0.09
14 0.1
15 0.1
16 0.12
17 0.15
18 0.18
19 0.18
20 0.19
21 0.19
22 0.2
23 0.21
24 0.26
25 0.21
26 0.18
27 0.18
28 0.17
29 0.15
30 0.14
31 0.13
32 0.07
33 0.09
34 0.1
35 0.13
36 0.16
37 0.21
38 0.2
39 0.2
40 0.2
41 0.19
42 0.19
43 0.18
44 0.22
45 0.2
46 0.22
47 0.22
48 0.22
49 0.22
50 0.21
51 0.19
52 0.12
53 0.09
54 0.08
55 0.07
56 0.06
57 0.07
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.07
71 0.09
72 0.11
73 0.18
74 0.27
75 0.36
76 0.45
77 0.55
78 0.64
79 0.72
80 0.82
81 0.84
82 0.85
83 0.87
84 0.88
85 0.83
86 0.83
87 0.76
88 0.72
89 0.63
90 0.57
91 0.47
92 0.37
93 0.32
94 0.22
95 0.18
96 0.11
97 0.1
98 0.06
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.06
110 0.08
111 0.08
112 0.08
113 0.09
114 0.1
115 0.09
116 0.1
117 0.11
118 0.09
119 0.1
120 0.09
121 0.1
122 0.1
123 0.11
124 0.1
125 0.11
126 0.12
127 0.13
128 0.17
129 0.16
130 0.14
131 0.13
132 0.13
133 0.13
134 0.12
135 0.11
136 0.07
137 0.08
138 0.08
139 0.08
140 0.09
141 0.09
142 0.08
143 0.08
144 0.07
145 0.07
146 0.07
147 0.07
148 0.07
149 0.05
150 0.05
151 0.05
152 0.05
153 0.06
154 0.07
155 0.08
156 0.09
157 0.1
158 0.11
159 0.11
160 0.11
161 0.12
162 0.13
163 0.16
164 0.16
165 0.21
166 0.22
167 0.25
168 0.31
169 0.35
170 0.35
171 0.31
172 0.3
173 0.27
174 0.25
175 0.22
176 0.17
177 0.11
178 0.1
179 0.08
180 0.07
181 0.06
182 0.06
183 0.06
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.04
190 0.03
191 0.03
192 0.03
193 0.08
194 0.08
195 0.08
196 0.08
197 0.09
198 0.09
199 0.1
200 0.1
201 0.05
202 0.05
203 0.05
204 0.05
205 0.04
206 0.04
207 0.04
208 0.05
209 0.05
210 0.05
211 0.04
212 0.05
213 0.07
214 0.07
215 0.08
216 0.08
217 0.08
218 0.08
219 0.09
220 0.1
221 0.16
222 0.17
223 0.18
224 0.2
225 0.2
226 0.2
227 0.19
228 0.17
229 0.11
230 0.1
231 0.09
232 0.1
233 0.09
234 0.09
235 0.1
236 0.09
237 0.08
238 0.08
239 0.08
240 0.05
241 0.05
242 0.05
243 0.05
244 0.06
245 0.07
246 0.06
247 0.06
248 0.06
249 0.07
250 0.11
251 0.12
252 0.16
253 0.15
254 0.25
255 0.33
256 0.35
257 0.36
258 0.33
259 0.38
260 0.38
261 0.4
262 0.34
263 0.3
264 0.31
265 0.3
266 0.3
267 0.23
268 0.2
269 0.17
270 0.13
271 0.09
272 0.06
273 0.05
274 0.05
275 0.05
276 0.05
277 0.04
278 0.05
279 0.05
280 0.06
281 0.04
282 0.05
283 0.05
284 0.05
285 0.05
286 0.05
287 0.04
288 0.04
289 0.04
290 0.03
291 0.03
292 0.03
293 0.03
294 0.03
295 0.04
296 0.05
297 0.06
298 0.06
299 0.07
300 0.07
301 0.07
302 0.08
303 0.09
304 0.11
305 0.11
306 0.11
307 0.12
308 0.15
309 0.17
310 0.16
311 0.15
312 0.13
313 0.13
314 0.13
315 0.12
316 0.12
317 0.11
318 0.12
319 0.13
320 0.17
321 0.18
322 0.18
323 0.2
324 0.21
325 0.21
326 0.23
327 0.23
328 0.24
329 0.23
330 0.25
331 0.27
332 0.22
333 0.24
334 0.22
335 0.22
336 0.19
337 0.22
338 0.24
339 0.2
340 0.25
341 0.24
342 0.25
343 0.24
344 0.24
345 0.21
346 0.17
347 0.19
348 0.21
349 0.26
350 0.32
351 0.31
352 0.3
353 0.29
354 0.34
355 0.35
356 0.29
357 0.28
358 0.22
359 0.25
360 0.27
361 0.28
362 0.25
363 0.27
364 0.27