Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9W920

Protein Details
Accession A0A0C9W920    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-44AELVKQYLQNKRKTKKRKVEESGDSNHydrophilic
NLS Segment(s)
PositionSequence
29-36KRKTKKRK
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 2
Family & Domain DBs
Amino Acid Sequences NDRRRHTYLEKFENDWPVAELVKQYLQNKRKTKKRKVEESGDSNEDRRGAKRSRFEDFDDDEDEQEMDSGGGRESGAEGSGGNEDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.44
3 0.36
4 0.27
5 0.23
6 0.2
7 0.16
8 0.12
9 0.15
10 0.18
11 0.21
12 0.29
13 0.36
14 0.45
15 0.53
16 0.6
17 0.67
18 0.74
19 0.81
20 0.82
21 0.85
22 0.87
23 0.85
24 0.85
25 0.82
26 0.78
27 0.71
28 0.64
29 0.54
30 0.44
31 0.37
32 0.3
33 0.23
34 0.18
35 0.19
36 0.21
37 0.26
38 0.34
39 0.37
40 0.4
41 0.43
42 0.45
43 0.45
44 0.44
45 0.41
46 0.36
47 0.33
48 0.28
49 0.25
50 0.22
51 0.15
52 0.12
53 0.09
54 0.05
55 0.06
56 0.06
57 0.05
58 0.06
59 0.05
60 0.06
61 0.06
62 0.07
63 0.07
64 0.06
65 0.06
66 0.07
67 0.09