Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9WFY0

Protein Details
Accession A0A0C9WFY0    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
108-131APPPMPPKPTEKPKWKPPPVVSPPHydrophilic
NLS Segment(s)
PositionSequence
41-52RPKPGGLQWKPK
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSDQSPPPKPKVGSLRDRIAAFENKGAASSPQGPAAAPVPRPKPGGLQWKPKPPSPPPSPDRAQTVEKKVAGVGGMSASDAMESIGRGGTLKERMAALQGRGAFSGGAPPPMPPKPTEKPKWKPPPVVSPPADEDQKEFIASPGAREASRSPPPRAIAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.64
4 0.63
5 0.56
6 0.51
7 0.48
8 0.39
9 0.35
10 0.3
11 0.24
12 0.24
13 0.23
14 0.19
15 0.17
16 0.18
17 0.16
18 0.16
19 0.17
20 0.16
21 0.17
22 0.19
23 0.19
24 0.18
25 0.23
26 0.24
27 0.28
28 0.3
29 0.29
30 0.31
31 0.35
32 0.43
33 0.44
34 0.51
35 0.54
36 0.63
37 0.65
38 0.63
39 0.63
40 0.58
41 0.6
42 0.57
43 0.59
44 0.53
45 0.57
46 0.56
47 0.52
48 0.51
49 0.45
50 0.44
51 0.4
52 0.43
53 0.4
54 0.38
55 0.35
56 0.3
57 0.27
58 0.21
59 0.15
60 0.09
61 0.05
62 0.04
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.04
76 0.06
77 0.09
78 0.09
79 0.1
80 0.1
81 0.1
82 0.13
83 0.14
84 0.12
85 0.13
86 0.14
87 0.14
88 0.13
89 0.14
90 0.1
91 0.09
92 0.13
93 0.1
94 0.11
95 0.11
96 0.11
97 0.16
98 0.18
99 0.2
100 0.17
101 0.25
102 0.32
103 0.42
104 0.51
105 0.57
106 0.64
107 0.73
108 0.83
109 0.83
110 0.84
111 0.8
112 0.81
113 0.78
114 0.79
115 0.7
116 0.63
117 0.6
118 0.55
119 0.51
120 0.4
121 0.35
122 0.3
123 0.29
124 0.25
125 0.21
126 0.16
127 0.21
128 0.21
129 0.2
130 0.21
131 0.22
132 0.21
133 0.23
134 0.26
135 0.27
136 0.37
137 0.41
138 0.4
139 0.45