Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9W652

Protein Details
Accession A0A0C9W652   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
75-103AEWMAKKKAKAKQKRESTKKRGEHRASVWHydrophilic
NLS Segment(s)
PositionSequence
80-112KKKAKAKQKRESTKKRGEHRASVWTTKPRRVKR
Subcellular Location(s) nucl 19, cyto 4, mito 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MSSDEESAGVGAISERETQFVPRSDDDDVLWEVQEITAERGKKYKVKWLGDDPATGKPWPQSWVDKHDCTDQLVAEWMAKKKAKAKQKRESTKKRGEHRASVWTTKPRRVKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.11
4 0.12
5 0.15
6 0.19
7 0.22
8 0.25
9 0.24
10 0.26
11 0.27
12 0.27
13 0.24
14 0.23
15 0.2
16 0.16
17 0.15
18 0.12
19 0.1
20 0.09
21 0.1
22 0.07
23 0.09
24 0.12
25 0.13
26 0.13
27 0.16
28 0.19
29 0.23
30 0.24
31 0.31
32 0.36
33 0.39
34 0.43
35 0.46
36 0.5
37 0.46
38 0.46
39 0.39
40 0.34
41 0.31
42 0.27
43 0.21
44 0.16
45 0.16
46 0.16
47 0.17
48 0.19
49 0.21
50 0.3
51 0.34
52 0.35
53 0.35
54 0.37
55 0.36
56 0.32
57 0.29
58 0.21
59 0.16
60 0.16
61 0.14
62 0.12
63 0.14
64 0.14
65 0.19
66 0.2
67 0.22
68 0.28
69 0.35
70 0.44
71 0.52
72 0.61
73 0.66
74 0.76
75 0.84
76 0.88
77 0.92
78 0.92
79 0.92
80 0.9
81 0.89
82 0.89
83 0.85
84 0.83
85 0.77
86 0.77
87 0.72
88 0.69
89 0.66
90 0.66
91 0.65
92 0.65