Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9V7V8

Protein Details
Accession A0A0C9V7V8   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
43-84HSDAVRRTRRGRPKSNNRSPTTSTPKLPRRRCTQRIPILIKCHydrophilic
NLS Segment(s)
PositionSequence
49-58RTRRGRPKSN
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MWVIFYAVSCSIRQARSLHPRLMPHWPQAAGNVKRMLGSSQAHSDAVRRTRRGRPKSNNRSPTTSTPKLPRRRCTQRIPILIKCLDCIHTCRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.32
3 0.41
4 0.47
5 0.48
6 0.47
7 0.49
8 0.49
9 0.56
10 0.51
11 0.45
12 0.43
13 0.39
14 0.35
15 0.37
16 0.43
17 0.35
18 0.36
19 0.33
20 0.28
21 0.28
22 0.28
23 0.24
24 0.18
25 0.17
26 0.15
27 0.16
28 0.16
29 0.16
30 0.16
31 0.17
32 0.17
33 0.23
34 0.25
35 0.26
36 0.3
37 0.38
38 0.49
39 0.56
40 0.62
41 0.66
42 0.74
43 0.82
44 0.88
45 0.88
46 0.83
47 0.8
48 0.75
49 0.73
50 0.71
51 0.64
52 0.59
53 0.59
54 0.64
55 0.68
56 0.71
57 0.7
58 0.71
59 0.78
60 0.8
61 0.81
62 0.82
63 0.82
64 0.83
65 0.83
66 0.77
67 0.74
68 0.69
69 0.59
70 0.51
71 0.43
72 0.36
73 0.31