Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6BLY1

Protein Details
Accession Q6BLY1    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
171-199IDPRTLNRAERKRLVKKNELQHKRNLKNQHydrophilic
NLS Segment(s)
PositionSequence
115-125AARKGIKAKAK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
KEGG dha:DEHA2F09834g  -  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSEQQFKPVTVDKPIPNTYDLGNLATFDPNPLDNDKLKDESQKEEYLTSVTRDNVQLLINQILSLPVKTTTDSQGSSTGQNSTMTLIQLPDPTTQLPREKAIPKTKAPTKWEQFAARKGIKAKAKDGKMVFDEATGEWVPKWGYKGKNKELDDQWLVEVDDKVKGTEDELIDPRTLNRAERKRLVKKNELQHKRNLKNQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.46
3 0.41
4 0.39
5 0.34
6 0.32
7 0.29
8 0.23
9 0.2
10 0.18
11 0.18
12 0.18
13 0.17
14 0.13
15 0.13
16 0.12
17 0.14
18 0.16
19 0.18
20 0.2
21 0.24
22 0.26
23 0.29
24 0.29
25 0.34
26 0.34
27 0.37
28 0.39
29 0.38
30 0.35
31 0.32
32 0.31
33 0.26
34 0.24
35 0.2
36 0.18
37 0.16
38 0.17
39 0.17
40 0.17
41 0.16
42 0.15
43 0.15
44 0.14
45 0.15
46 0.13
47 0.12
48 0.11
49 0.11
50 0.11
51 0.09
52 0.08
53 0.07
54 0.08
55 0.09
56 0.11
57 0.13
58 0.15
59 0.16
60 0.16
61 0.18
62 0.19
63 0.19
64 0.18
65 0.16
66 0.14
67 0.14
68 0.13
69 0.11
70 0.1
71 0.09
72 0.09
73 0.08
74 0.08
75 0.09
76 0.1
77 0.1
78 0.1
79 0.1
80 0.12
81 0.14
82 0.16
83 0.16
84 0.16
85 0.21
86 0.24
87 0.3
88 0.37
89 0.39
90 0.39
91 0.44
92 0.49
93 0.5
94 0.51
95 0.54
96 0.49
97 0.49
98 0.51
99 0.51
100 0.49
101 0.47
102 0.49
103 0.41
104 0.4
105 0.38
106 0.41
107 0.39
108 0.38
109 0.41
110 0.41
111 0.42
112 0.45
113 0.43
114 0.4
115 0.37
116 0.37
117 0.29
118 0.21
119 0.21
120 0.14
121 0.17
122 0.13
123 0.12
124 0.09
125 0.1
126 0.11
127 0.11
128 0.14
129 0.17
130 0.25
131 0.33
132 0.43
133 0.5
134 0.59
135 0.61
136 0.66
137 0.62
138 0.62
139 0.56
140 0.47
141 0.39
142 0.31
143 0.29
144 0.23
145 0.2
146 0.14
147 0.14
148 0.13
149 0.13
150 0.13
151 0.13
152 0.12
153 0.17
154 0.17
155 0.19
156 0.21
157 0.23
158 0.22
159 0.22
160 0.22
161 0.23
162 0.23
163 0.23
164 0.31
165 0.38
166 0.46
167 0.55
168 0.64
169 0.69
170 0.77
171 0.81
172 0.81
173 0.81
174 0.83
175 0.86
176 0.86
177 0.8
178 0.81
179 0.83
180 0.8