Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VSI6

Protein Details
Accession A0A0C9VSI6   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
58-84PAEVPKNPSKRLKKVLRRFQQNVRSLKHydrophilic
NLS Segment(s)
PositionSequence
55-88QRGPAEVPKNPSKRLKKVLRRFQQNVRSLKPRRR
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
Amino Acid Sequences MEAIEAEFKDDSDSLLDLPATMPVGQSQDVVEVDQHGVDPLDFMATGYGPPRPHQRGPAEVPKNPSKRLKKVLRRFQQNVRSLKPRRRDTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.08
5 0.08
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.09
12 0.09
13 0.09
14 0.09
15 0.1
16 0.1
17 0.1
18 0.09
19 0.08
20 0.08
21 0.07
22 0.07
23 0.05
24 0.05
25 0.05
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.03
32 0.03
33 0.04
34 0.04
35 0.07
36 0.07
37 0.1
38 0.17
39 0.23
40 0.24
41 0.31
42 0.35
43 0.38
44 0.44
45 0.53
46 0.51
47 0.48
48 0.53
49 0.55
50 0.55
51 0.54
52 0.58
53 0.56
54 0.6
55 0.67
56 0.72
57 0.74
58 0.81
59 0.86
60 0.87
61 0.88
62 0.86
63 0.86
64 0.85
65 0.82
66 0.79
67 0.76
68 0.76
69 0.74
70 0.76
71 0.76