Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9W3C9

Protein Details
Accession A0A0C9W3C9   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
82-106EIEQHKQRISRHRHHWHRAKTPPGYBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 12, cyto 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013882  Ctp1_C  
IPR033316  RBBP8-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF08573  SAE2  
Amino Acid Sequences TINSRFSIKKDHNQGLNYQYDAVVRNREERKHMLGGDCECCQDYYKAVGPLPTPRVPLWQSPKRKAPYSPHLPANDKENADEIEQHKQRISRHRHHWHRAKTPPGYWDIGFPDTQEASDINRRAAEMHKRKLIDVETEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.6
3 0.55
4 0.47
5 0.38
6 0.3
7 0.26
8 0.26
9 0.23
10 0.23
11 0.21
12 0.29
13 0.33
14 0.36
15 0.4
16 0.42
17 0.45
18 0.44
19 0.45
20 0.4
21 0.39
22 0.39
23 0.37
24 0.33
25 0.28
26 0.23
27 0.22
28 0.2
29 0.16
30 0.14
31 0.15
32 0.18
33 0.19
34 0.19
35 0.2
36 0.19
37 0.24
38 0.28
39 0.25
40 0.24
41 0.22
42 0.26
43 0.27
44 0.32
45 0.36
46 0.39
47 0.46
48 0.49
49 0.57
50 0.56
51 0.57
52 0.56
53 0.55
54 0.56
55 0.57
56 0.56
57 0.53
58 0.53
59 0.53
60 0.48
61 0.45
62 0.39
63 0.31
64 0.26
65 0.23
66 0.2
67 0.17
68 0.2
69 0.17
70 0.23
71 0.24
72 0.24
73 0.24
74 0.26
75 0.31
76 0.37
77 0.44
78 0.45
79 0.54
80 0.64
81 0.73
82 0.8
83 0.85
84 0.85
85 0.85
86 0.84
87 0.82
88 0.76
89 0.69
90 0.63
91 0.57
92 0.51
93 0.41
94 0.36
95 0.31
96 0.28
97 0.25
98 0.21
99 0.21
100 0.17
101 0.17
102 0.15
103 0.12
104 0.14
105 0.22
106 0.23
107 0.21
108 0.21
109 0.21
110 0.23
111 0.29
112 0.36
113 0.38
114 0.45
115 0.51
116 0.51
117 0.52
118 0.56
119 0.52
120 0.47