Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VFY1

Protein Details
Accession A0A0C9VFY1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
22-41KAAAAPKKGKRHEPPKKPGLBasic
NLS Segment(s)
PositionSequence
18-39RHAAKAAAAPKKGKRHEPPKKP
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MVQGKTKGLQSKTSSSSRHAAKAAAAPKKGKRHEPPKKPGLVQQATMRKGLSSQQALKAKVTKSIEQQMVSAASAGKLTIMKNSAPEPEPAKSSSSKGGKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.52
4 0.47
5 0.46
6 0.41
7 0.36
8 0.31
9 0.35
10 0.38
11 0.37
12 0.37
13 0.38
14 0.43
15 0.52
16 0.54
17 0.57
18 0.6
19 0.65
20 0.72
21 0.78
22 0.8
23 0.79
24 0.8
25 0.72
26 0.68
27 0.67
28 0.58
29 0.5
30 0.48
31 0.47
32 0.43
33 0.42
34 0.36
35 0.26
36 0.24
37 0.24
38 0.21
39 0.18
40 0.18
41 0.25
42 0.3
43 0.31
44 0.32
45 0.33
46 0.29
47 0.32
48 0.33
49 0.29
50 0.29
51 0.36
52 0.37
53 0.33
54 0.33
55 0.28
56 0.25
57 0.22
58 0.18
59 0.11
60 0.08
61 0.07
62 0.07
63 0.06
64 0.07
65 0.07
66 0.1
67 0.12
68 0.13
69 0.15
70 0.17
71 0.21
72 0.21
73 0.24
74 0.25
75 0.26
76 0.28
77 0.27
78 0.29
79 0.27
80 0.29
81 0.35