Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9V5T0

Protein Details
Accession A0A0C9V5T0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
54-73AQKKKAKETSAKKRGKGTRIBasic
NLS Segment(s)
PositionSequence
43-72KAKGSVREWGIAQKKKAKETSAKKRGKGTR
Subcellular Location(s) mito 16.5, cyto_mito 10.5, extr 4, cyto 3.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPAIKQYAYFAGAYSIFVRGSWFLNATLVGAYWLALRVIAPGKAKGSVREWGIAQKKKAKETSAKKRGKGTRIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.1
4 0.1
5 0.11
6 0.1
7 0.11
8 0.11
9 0.11
10 0.1
11 0.11
12 0.11
13 0.1
14 0.09
15 0.07
16 0.06
17 0.05
18 0.05
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.05
25 0.06
26 0.08
27 0.09
28 0.09
29 0.1
30 0.13
31 0.14
32 0.16
33 0.18
34 0.2
35 0.2
36 0.21
37 0.21
38 0.27
39 0.35
40 0.38
41 0.4
42 0.44
43 0.48
44 0.53
45 0.57
46 0.55
47 0.57
48 0.62
49 0.69
50 0.71
51 0.75
52 0.73
53 0.78
54 0.8