Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9W830

Protein Details
Accession A0A0C9W830    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
86-113LNTSTPSKPKPKPRSRRRSRSPSYEPSPHydrophilic
NLS Segment(s)
PositionSequence
93-105KPKPKPRSRRRSR
Subcellular Location(s) mito 12.5, nucl 9.5, cyto_mito 8.333, cyto_nucl 6.833, cyto 3
Family & Domain DBs
Amino Acid Sequences MSKSGSVLKSAPSGPTLIASASTPSSSSKPYTFPQPTPSYSSSKPYIFPPPSSSSQPKPPPHLPFPNRDNNPDPDLPFDISFSAPLNTSTPSKPKPKPRSRRRSRSPSYEPSPPSFSEGGSAKSTSLQTSKTTSPRMGASTGTPTTASLLTERARLLAELAALKRARAASSGGSVGAGVGVGVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.12
5 0.12
6 0.11
7 0.12
8 0.12
9 0.12
10 0.11
11 0.13
12 0.15
13 0.17
14 0.2
15 0.2
16 0.23
17 0.25
18 0.35
19 0.38
20 0.39
21 0.44
22 0.46
23 0.46
24 0.49
25 0.5
26 0.46
27 0.42
28 0.45
29 0.41
30 0.37
31 0.36
32 0.33
33 0.39
34 0.36
35 0.36
36 0.37
37 0.38
38 0.4
39 0.45
40 0.47
41 0.41
42 0.48
43 0.55
44 0.53
45 0.55
46 0.59
47 0.59
48 0.61
49 0.68
50 0.62
51 0.61
52 0.63
53 0.65
54 0.6
55 0.58
56 0.55
57 0.48
58 0.5
59 0.43
60 0.38
61 0.3
62 0.3
63 0.26
64 0.22
65 0.19
66 0.14
67 0.12
68 0.12
69 0.1
70 0.08
71 0.07
72 0.08
73 0.08
74 0.09
75 0.11
76 0.12
77 0.16
78 0.2
79 0.28
80 0.34
81 0.44
82 0.53
83 0.62
84 0.72
85 0.78
86 0.85
87 0.88
88 0.93
89 0.92
90 0.92
91 0.88
92 0.87
93 0.84
94 0.81
95 0.75
96 0.71
97 0.64
98 0.57
99 0.53
100 0.44
101 0.4
102 0.31
103 0.26
104 0.23
105 0.21
106 0.2
107 0.18
108 0.18
109 0.14
110 0.16
111 0.16
112 0.15
113 0.15
114 0.14
115 0.15
116 0.19
117 0.24
118 0.27
119 0.3
120 0.29
121 0.29
122 0.3
123 0.3
124 0.27
125 0.23
126 0.2
127 0.22
128 0.22
129 0.2
130 0.18
131 0.16
132 0.17
133 0.16
134 0.15
135 0.1
136 0.13
137 0.13
138 0.16
139 0.15
140 0.14
141 0.14
142 0.14
143 0.14
144 0.11
145 0.12
146 0.14
147 0.14
148 0.2
149 0.19
150 0.19
151 0.21
152 0.21
153 0.2
154 0.18
155 0.2
156 0.16
157 0.2
158 0.21
159 0.18
160 0.17
161 0.16
162 0.14
163 0.11
164 0.08