Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9W7T5

Protein Details
Accession A0A0C9W7T5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-102LCLNTLKHPHPRPKRLTHHLTDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MSRAPHPRPKCLTHALHPNALTHVLNAHPRPEHLPPCIPPASRTPQPRPKCLTPHVLSALPASQAPYPCPKHLTKHLTRALCLNTLKHPHPRPKRLTHHLTDTHTRALNAHPRPECLPPHVPPVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.63
3 0.62
4 0.57
5 0.51
6 0.43
7 0.4
8 0.32
9 0.21
10 0.19
11 0.16
12 0.21
13 0.21
14 0.22
15 0.21
16 0.22
17 0.26
18 0.31
19 0.32
20 0.31
21 0.35
22 0.33
23 0.38
24 0.41
25 0.36
26 0.32
27 0.34
28 0.37
29 0.38
30 0.44
31 0.47
32 0.53
33 0.57
34 0.63
35 0.64
36 0.62
37 0.63
38 0.6
39 0.6
40 0.52
41 0.51
42 0.47
43 0.4
44 0.34
45 0.29
46 0.25
47 0.16
48 0.14
49 0.1
50 0.09
51 0.09
52 0.1
53 0.17
54 0.18
55 0.19
56 0.24
57 0.24
58 0.28
59 0.37
60 0.44
61 0.43
62 0.5
63 0.55
64 0.52
65 0.51
66 0.5
67 0.43
68 0.39
69 0.35
70 0.27
71 0.26
72 0.3
73 0.33
74 0.38
75 0.44
76 0.49
77 0.58
78 0.66
79 0.69
80 0.74
81 0.81
82 0.81
83 0.82
84 0.77
85 0.76
86 0.72
87 0.7
88 0.67
89 0.6
90 0.56
91 0.49
92 0.44
93 0.36
94 0.36
95 0.4
96 0.38
97 0.43
98 0.4
99 0.42
100 0.45
101 0.49
102 0.46
103 0.44
104 0.46
105 0.41