Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9V1L2

Protein Details
Accession A0A0C9V1L2   
Localization Confidence Low
Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
88-110WSVVPFKKPKHGRLLRNERTFNYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 8.333, mito_nucl 5.333, nucl 5, mito 4.5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027806  HARBI1_dom  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF13359  DDE_Tnp_4  
Amino Acid Sequences MNGSGLPLFQKPGFYGETVYNHKSCYSLNCQLVMMPHNLLIVDYAMGHPGSAHDAYAFQSTRIAKEHATLLCDDEWLWANSAYSSAKWSVVPFKKPKHGRLLRNERTFNYYLSKVFFFVSYFLKTYIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.26
5 0.3
6 0.33
7 0.31
8 0.3
9 0.29
10 0.28
11 0.25
12 0.25
13 0.27
14 0.31
15 0.33
16 0.33
17 0.32
18 0.32
19 0.33
20 0.29
21 0.22
22 0.14
23 0.13
24 0.12
25 0.12
26 0.11
27 0.09
28 0.07
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.07
38 0.07
39 0.07
40 0.06
41 0.07
42 0.08
43 0.11
44 0.11
45 0.09
46 0.12
47 0.12
48 0.14
49 0.15
50 0.15
51 0.12
52 0.13
53 0.17
54 0.14
55 0.15
56 0.14
57 0.14
58 0.13
59 0.13
60 0.11
61 0.09
62 0.1
63 0.09
64 0.1
65 0.08
66 0.08
67 0.08
68 0.1
69 0.09
70 0.08
71 0.09
72 0.09
73 0.1
74 0.1
75 0.12
76 0.2
77 0.25
78 0.33
79 0.39
80 0.45
81 0.54
82 0.6
83 0.65
84 0.67
85 0.71
86 0.72
87 0.75
88 0.8
89 0.8
90 0.83
91 0.8
92 0.71
93 0.69
94 0.61
95 0.52
96 0.47
97 0.39
98 0.32
99 0.32
100 0.3
101 0.24
102 0.24
103 0.22
104 0.17
105 0.17
106 0.19
107 0.19
108 0.2