Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9W9J2

Protein Details
Accession A0A0C9W9J2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGGGGRRRQRRKTMIRKARRAIAPTBasic
NLS Segment(s)
PositionSequence
5-21GRRRQRRKTMIRKARRA
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MGGGGRRRQRRKTMIRKARRAIAPTAPPMLAFTTVLCDIIEDESEFGEGPSEFELLELGVIDDEIGAVMEELLGAVDVADDGAVGEDDGAVGEEDGAFGEEDGAFGEEDGAFGEEEVAGEEEGGEADGVISG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.93
4 0.89
5 0.87
6 0.82
7 0.75
8 0.69
9 0.66
10 0.61
11 0.54
12 0.5
13 0.41
14 0.34
15 0.31
16 0.27
17 0.2
18 0.14
19 0.11
20 0.11
21 0.11
22 0.12
23 0.1
24 0.09
25 0.08
26 0.09
27 0.09
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.05
34 0.06
35 0.05
36 0.05
37 0.06
38 0.06
39 0.05
40 0.05
41 0.06
42 0.04
43 0.04
44 0.04
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.02
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.04
84 0.03
85 0.03
86 0.04
87 0.04
88 0.04
89 0.05
90 0.06
91 0.05
92 0.05
93 0.06
94 0.05
95 0.05
96 0.06
97 0.06
98 0.05
99 0.05
100 0.06
101 0.05
102 0.05
103 0.06
104 0.07
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.05
112 0.04