Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9UZC6

Protein Details
Accession A0A0C9UZC6    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
161-185REDEERAKERRHREREERREERLDEAcidic
NLS Segment(s)
PositionSequence
167-177AKERRHREREE
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046528  DUF6593  
Pfam View protein in Pfam  
PF20236  DUF6593  
Amino Acid Sequences MRLILSHSDVNNTDISDEEGRKLYNTSTPTFAWNDKTTITKYPHGEGGNPEIMGIIEYHMLHDAKVQFMGKEVMLKDLLKEETFSSGRYFIGPDDRKYVRKHNSSTCQLYEENSDMELVKFHQKNWGIMKPSHPPYLDISSSVEHMLDLVIITYLCADKLREDEERAKERRHREREERREERLDEFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.19
4 0.19
5 0.19
6 0.2
7 0.2
8 0.21
9 0.21
10 0.19
11 0.2
12 0.23
13 0.23
14 0.25
15 0.25
16 0.28
17 0.3
18 0.31
19 0.31
20 0.29
21 0.28
22 0.26
23 0.29
24 0.28
25 0.31
26 0.34
27 0.34
28 0.34
29 0.35
30 0.39
31 0.37
32 0.36
33 0.32
34 0.33
35 0.29
36 0.26
37 0.24
38 0.18
39 0.17
40 0.15
41 0.12
42 0.07
43 0.06
44 0.06
45 0.06
46 0.09
47 0.09
48 0.08
49 0.12
50 0.12
51 0.11
52 0.13
53 0.13
54 0.1
55 0.12
56 0.13
57 0.1
58 0.12
59 0.12
60 0.12
61 0.13
62 0.13
63 0.12
64 0.13
65 0.14
66 0.11
67 0.12
68 0.1
69 0.14
70 0.14
71 0.15
72 0.13
73 0.13
74 0.13
75 0.12
76 0.12
77 0.08
78 0.17
79 0.19
80 0.19
81 0.23
82 0.25
83 0.29
84 0.32
85 0.4
86 0.39
87 0.43
88 0.47
89 0.5
90 0.56
91 0.58
92 0.59
93 0.52
94 0.47
95 0.4
96 0.36
97 0.3
98 0.23
99 0.17
100 0.13
101 0.13
102 0.1
103 0.1
104 0.09
105 0.08
106 0.15
107 0.16
108 0.16
109 0.23
110 0.24
111 0.29
112 0.35
113 0.39
114 0.36
115 0.37
116 0.41
117 0.43
118 0.45
119 0.45
120 0.39
121 0.35
122 0.35
123 0.39
124 0.35
125 0.28
126 0.26
127 0.22
128 0.22
129 0.2
130 0.16
131 0.1
132 0.09
133 0.08
134 0.06
135 0.05
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.05
142 0.05
143 0.06
144 0.07
145 0.08
146 0.12
147 0.16
148 0.18
149 0.24
150 0.31
151 0.39
152 0.47
153 0.5
154 0.55
155 0.58
156 0.65
157 0.71
158 0.73
159 0.75
160 0.77
161 0.84
162 0.88
163 0.91
164 0.88
165 0.85
166 0.83
167 0.76