Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9VDZ4

Protein Details
Accession A0A0C9VDZ4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
54-73PKTGKACKEKWKRLRTTFYAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, cyto 8, mito 3, pero 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024752  Myb/SANT-like_dom  
Pfam View protein in Pfam  
PF12776  Myb_DNA-bind_3  
Amino Acid Sequences NTSSASWSPAEVIVLIDKVIAQKSKAGNGQNFRPAVWSLITSCKGLANPAKGGPKTGKACKEKWKRLRTTFYAVDHLTHASGFAYSEALGANIGVENESVWQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.09
6 0.11
7 0.12
8 0.11
9 0.16
10 0.18
11 0.23
12 0.27
13 0.31
14 0.35
15 0.38
16 0.43
17 0.44
18 0.42
19 0.37
20 0.35
21 0.3
22 0.25
23 0.21
24 0.17
25 0.12
26 0.17
27 0.18
28 0.16
29 0.16
30 0.15
31 0.14
32 0.17
33 0.18
34 0.16
35 0.16
36 0.19
37 0.23
38 0.21
39 0.23
40 0.22
41 0.25
42 0.28
43 0.32
44 0.37
45 0.38
46 0.43
47 0.51
48 0.61
49 0.64
50 0.7
51 0.74
52 0.75
53 0.79
54 0.82
55 0.77
56 0.74
57 0.69
58 0.62
59 0.58
60 0.49
61 0.42
62 0.34
63 0.29
64 0.22
65 0.16
66 0.13
67 0.08
68 0.08
69 0.07
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05