Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9WEB2

Protein Details
Accession A0A0C9WEB2   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
80-105CRGRHRVYAMTKRAKRKQEKAAILSQHydrophilic
NLS Segment(s)
PositionSequence
93-95AKR
Subcellular Location(s) nucl 19, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences ITGYPDNLHYGPQYPGGSSSPVTTSGQASSLSASGSVGQPPAPAEPVTSTSFAQEVRRCSVRGCNKPLAPDVANKMCDECRGRHRVYAMTKRAKRKQEKAAILSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.2
4 0.21
5 0.19
6 0.19
7 0.15
8 0.17
9 0.17
10 0.16
11 0.16
12 0.14
13 0.15
14 0.14
15 0.13
16 0.11
17 0.1
18 0.09
19 0.08
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.07
26 0.07
27 0.08
28 0.08
29 0.09
30 0.08
31 0.08
32 0.09
33 0.12
34 0.14
35 0.14
36 0.14
37 0.13
38 0.13
39 0.14
40 0.16
41 0.16
42 0.17
43 0.19
44 0.21
45 0.21
46 0.21
47 0.29
48 0.35
49 0.4
50 0.44
51 0.47
52 0.47
53 0.49
54 0.5
55 0.45
56 0.37
57 0.33
58 0.33
59 0.31
60 0.3
61 0.28
62 0.28
63 0.24
64 0.28
65 0.28
66 0.26
67 0.3
68 0.36
69 0.38
70 0.4
71 0.42
72 0.44
73 0.51
74 0.56
75 0.58
76 0.61
77 0.67
78 0.74
79 0.79
80 0.83
81 0.83
82 0.82
83 0.83
84 0.83
85 0.86