Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9W592

Protein Details
Accession A0A0C9W592    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MTKRKRGRRGAKKAKNRSEEDDDRBasic
NLS Segment(s)
PositionSequence
3-17KRKRGRRGAKKAKNR
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023267  RCMT  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0003723  F:RNA binding  
GO:0001510  P:RNA methylation  
Amino Acid Sequences MTKRKRGRRGAKKAKNRSEEDDDRGMLERADMNNERFSAYYQAQNIIPGDEWENFMDCLRRPLPTTFRITGSREIAHTLGHTIEETYVPLLNDVTFEDEAVPPPAQIPWYPEGLAWQFNVSKKVLRKSEEFKKFHSFLVHETEVVRAPVVSRDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.92
3 0.86
4 0.83
5 0.81
6 0.76
7 0.71
8 0.65
9 0.55
10 0.47
11 0.43
12 0.35
13 0.26
14 0.2
15 0.18
16 0.14
17 0.2
18 0.21
19 0.22
20 0.24
21 0.24
22 0.24
23 0.21
24 0.22
25 0.2
26 0.19
27 0.21
28 0.19
29 0.21
30 0.21
31 0.22
32 0.21
33 0.16
34 0.15
35 0.12
36 0.13
37 0.11
38 0.13
39 0.11
40 0.12
41 0.11
42 0.12
43 0.13
44 0.11
45 0.15
46 0.14
47 0.15
48 0.16
49 0.2
50 0.25
51 0.27
52 0.33
53 0.3
54 0.32
55 0.34
56 0.34
57 0.34
58 0.31
59 0.28
60 0.22
61 0.22
62 0.19
63 0.16
64 0.13
65 0.1
66 0.07
67 0.07
68 0.06
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.06
81 0.08
82 0.07
83 0.08
84 0.09
85 0.09
86 0.1
87 0.12
88 0.12
89 0.08
90 0.09
91 0.09
92 0.09
93 0.1
94 0.13
95 0.12
96 0.14
97 0.14
98 0.14
99 0.17
100 0.18
101 0.18
102 0.15
103 0.15
104 0.16
105 0.18
106 0.21
107 0.19
108 0.23
109 0.28
110 0.36
111 0.4
112 0.41
113 0.46
114 0.52
115 0.61
116 0.66
117 0.63
118 0.6
119 0.63
120 0.6
121 0.56
122 0.54
123 0.46
124 0.39
125 0.45
126 0.4
127 0.32
128 0.31
129 0.3
130 0.25
131 0.24
132 0.2
133 0.12
134 0.11