Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9W7M8

Protein Details
Accession A0A0C9W7M8   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
45-70AALVVIARKRRRRRIIRLQTDQRPLTHydrophilic
NLS Segment(s)
PositionSequence
52-58RKRRRRR
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MRRVPKFKSAQSPDQHLQVHPGCPQQARGTKYGAECNAGDIKDVAALVVIARKRRRRRIIRLQTDQRPLTTKSYYVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.58
3 0.47
4 0.46
5 0.39
6 0.36
7 0.3
8 0.31
9 0.27
10 0.26
11 0.28
12 0.29
13 0.32
14 0.33
15 0.32
16 0.31
17 0.31
18 0.32
19 0.34
20 0.27
21 0.23
22 0.2
23 0.2
24 0.2
25 0.17
26 0.16
27 0.11
28 0.11
29 0.09
30 0.09
31 0.06
32 0.04
33 0.04
34 0.03
35 0.07
36 0.09
37 0.14
38 0.21
39 0.31
40 0.4
41 0.51
42 0.61
43 0.68
44 0.78
45 0.84
46 0.88
47 0.9
48 0.92
49 0.91
50 0.89
51 0.87
52 0.78
53 0.7
54 0.63
55 0.55
56 0.5
57 0.44