Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9W7G7

Protein Details
Accession A0A0C9W7G7    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
205-230IMVRIPSSKPPKPPTRRRENTVILPHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 7, cyto_mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MSPTKSALTLLPQLPLSSSLPTSASTPSVTPSTSTTPSATTTSTSTTNPRAPSHSLLSTRDPLSLPIMTSDFRCFVAQVGDVFWLQDRVEEVMLWKKGWKRTTAWLAVYGSIIYLVGAFSDAHDAILPLFPLLTPPPTSQPPAPPPPSPTRSHFTSASLSTSTFPPPSPSPHAVHRLGSGARVHEPLLARASSGAGTRHTGPLFIMVRIPSSKPPKPPTRRRENTVILPHAAFDPRFNAYYSEQTACAQSAGVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.22
4 0.18
5 0.17
6 0.16
7 0.16
8 0.17
9 0.17
10 0.16
11 0.16
12 0.15
13 0.15
14 0.16
15 0.17
16 0.17
17 0.16
18 0.18
19 0.22
20 0.23
21 0.25
22 0.23
23 0.23
24 0.25
25 0.25
26 0.23
27 0.19
28 0.18
29 0.19
30 0.2
31 0.2
32 0.22
33 0.26
34 0.31
35 0.32
36 0.33
37 0.35
38 0.37
39 0.39
40 0.39
41 0.39
42 0.38
43 0.38
44 0.4
45 0.4
46 0.37
47 0.34
48 0.29
49 0.25
50 0.25
51 0.22
52 0.17
53 0.15
54 0.15
55 0.14
56 0.15
57 0.16
58 0.14
59 0.14
60 0.14
61 0.13
62 0.12
63 0.13
64 0.13
65 0.11
66 0.11
67 0.11
68 0.1
69 0.1
70 0.09
71 0.09
72 0.07
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.1
79 0.14
80 0.15
81 0.15
82 0.17
83 0.21
84 0.26
85 0.29
86 0.31
87 0.28
88 0.35
89 0.43
90 0.43
91 0.4
92 0.38
93 0.35
94 0.32
95 0.29
96 0.21
97 0.13
98 0.09
99 0.08
100 0.04
101 0.03
102 0.03
103 0.02
104 0.03
105 0.03
106 0.03
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.03
116 0.03
117 0.03
118 0.04
119 0.05
120 0.06
121 0.08
122 0.09
123 0.12
124 0.14
125 0.17
126 0.17
127 0.22
128 0.27
129 0.32
130 0.34
131 0.33
132 0.36
133 0.42
134 0.45
135 0.43
136 0.42
137 0.39
138 0.39
139 0.42
140 0.38
141 0.33
142 0.31
143 0.29
144 0.26
145 0.22
146 0.19
147 0.16
148 0.17
149 0.16
150 0.13
151 0.13
152 0.15
153 0.16
154 0.21
155 0.26
156 0.29
157 0.3
158 0.35
159 0.41
160 0.39
161 0.38
162 0.34
163 0.31
164 0.27
165 0.27
166 0.22
167 0.18
168 0.18
169 0.18
170 0.17
171 0.17
172 0.18
173 0.17
174 0.18
175 0.16
176 0.14
177 0.13
178 0.14
179 0.12
180 0.12
181 0.12
182 0.1
183 0.13
184 0.15
185 0.19
186 0.18
187 0.18
188 0.16
189 0.22
190 0.22
191 0.2
192 0.21
193 0.17
194 0.2
195 0.21
196 0.23
197 0.24
198 0.32
199 0.36
200 0.43
201 0.52
202 0.6
203 0.69
204 0.78
205 0.8
206 0.83
207 0.86
208 0.84
209 0.85
210 0.82
211 0.8
212 0.79
213 0.72
214 0.64
215 0.55
216 0.49
217 0.42
218 0.37
219 0.28
220 0.2
221 0.2
222 0.2
223 0.21
224 0.21
225 0.23
226 0.23
227 0.29
228 0.32
229 0.31
230 0.29
231 0.29
232 0.29
233 0.26
234 0.23