Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9W2L2

Protein Details
Accession A0A0C9W2L2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
76-96DNLKAKSKDKAHRHHDQHLSDBasic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto_nucl 11.5, cyto 9, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022234  DUF3759  
Pfam View protein in Pfam  
PF12585  DUF3759  
Amino Acid Sequences MSHEDYLKVVNEPHKAKLSHELIAAAASYEAMKAYNEHCEKNGKPVSHQKAKEFMAAASGAFIDGLFESKGLDAIDNLKAKSKDKAHRHHDQHLSDNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.39
4 0.45
5 0.43
6 0.37
7 0.35
8 0.31
9 0.24
10 0.24
11 0.21
12 0.12
13 0.08
14 0.06
15 0.05
16 0.04
17 0.04
18 0.04
19 0.05
20 0.05
21 0.07
22 0.15
23 0.17
24 0.18
25 0.2
26 0.25
27 0.25
28 0.33
29 0.37
30 0.29
31 0.31
32 0.41
33 0.47
34 0.5
35 0.52
36 0.45
37 0.46
38 0.47
39 0.44
40 0.35
41 0.27
42 0.2
43 0.18
44 0.16
45 0.1
46 0.08
47 0.06
48 0.05
49 0.05
50 0.03
51 0.03
52 0.05
53 0.04
54 0.04
55 0.05
56 0.05
57 0.06
58 0.06
59 0.06
60 0.06
61 0.08
62 0.14
63 0.16
64 0.17
65 0.22
66 0.24
67 0.26
68 0.33
69 0.4
70 0.44
71 0.52
72 0.62
73 0.64
74 0.73
75 0.78
76 0.8
77 0.8
78 0.76