Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9VP26

Protein Details
Accession A0A0C9VP26    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-25LERHTGRRDASRRKRCRIACAVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MGELERHTGRRDASRRKRCRIACAVIKIRCIMVHVNEHMMQITVTTSDSKGRKKKEIATVRNPTGRQKWEYTVLKKRETGFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.74
3 0.79
4 0.86
5 0.8
6 0.8
7 0.78
8 0.76
9 0.73
10 0.73
11 0.73
12 0.66
13 0.63
14 0.54
15 0.45
16 0.36
17 0.29
18 0.22
19 0.16
20 0.17
21 0.16
22 0.19
23 0.19
24 0.19
25 0.17
26 0.15
27 0.12
28 0.08
29 0.07
30 0.05
31 0.05
32 0.05
33 0.06
34 0.11
35 0.15
36 0.23
37 0.3
38 0.35
39 0.41
40 0.46
41 0.53
42 0.58
43 0.65
44 0.66
45 0.7
46 0.73
47 0.72
48 0.73
49 0.67
50 0.63
51 0.6
52 0.58
53 0.52
54 0.48
55 0.47
56 0.5
57 0.57
58 0.6
59 0.62
60 0.63
61 0.64
62 0.64