Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9LU79

Protein Details
Accession A0A0C9LU79   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
263-292EPSTPAPPGKARRKVLKKRTTKNSRGHLVTHydrophilic
NLS Segment(s)
PositionSequence
270-284PGKARRKVLKKRTTK
Subcellular Location(s) nucl 18, cyto_nucl 11.333, mito_nucl 10.833, cyto 3.5, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
IPR041913  POLD3_sf  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MQRALYEFSESQANVRAVYCITGTSLKNNQFTIQLVKDAELDGAKKGYKEITGIHVYSITSFDPDDFSIFYTACKDAPQLAIEDRVKCGILKNSNVVLRSITPTNRTVDGEKKSAPISNTKSLTSNTSTKPIPPSSNTSKATSTTTTTTGKRKGTLNFGPAATKKQIVAASPKSETPASKPVLKKSISKMKPKNEQDDLDVRMAKTSIKASDIFSDDEEEEEEQDQMREPQPAEDLDIVEIDNEDEDMEVVDTVEEKEPVQEEPSTPAPPGKARRKVLKKRTTKNSRGHLVTEEYWDWEMVDEAEAKSTTPTVPFKSKTPLTSPAAAKKATNSKNAKKPTGQSNLLSFFKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.22
4 0.17
5 0.19
6 0.18
7 0.11
8 0.13
9 0.17
10 0.18
11 0.23
12 0.3
13 0.35
14 0.38
15 0.39
16 0.38
17 0.35
18 0.36
19 0.36
20 0.3
21 0.28
22 0.26
23 0.25
24 0.25
25 0.23
26 0.22
27 0.17
28 0.16
29 0.13
30 0.16
31 0.16
32 0.15
33 0.16
34 0.17
35 0.17
36 0.18
37 0.18
38 0.22
39 0.26
40 0.26
41 0.25
42 0.24
43 0.23
44 0.22
45 0.21
46 0.15
47 0.1
48 0.1
49 0.1
50 0.11
51 0.11
52 0.12
53 0.1
54 0.12
55 0.12
56 0.12
57 0.12
58 0.13
59 0.13
60 0.12
61 0.12
62 0.12
63 0.13
64 0.15
65 0.16
66 0.15
67 0.16
68 0.23
69 0.25
70 0.25
71 0.24
72 0.23
73 0.22
74 0.2
75 0.23
76 0.23
77 0.26
78 0.27
79 0.3
80 0.34
81 0.36
82 0.36
83 0.33
84 0.27
85 0.23
86 0.24
87 0.24
88 0.21
89 0.22
90 0.23
91 0.25
92 0.26
93 0.26
94 0.26
95 0.29
96 0.32
97 0.32
98 0.31
99 0.3
100 0.29
101 0.3
102 0.28
103 0.29
104 0.31
105 0.35
106 0.35
107 0.34
108 0.35
109 0.33
110 0.36
111 0.32
112 0.31
113 0.26
114 0.28
115 0.27
116 0.28
117 0.32
118 0.32
119 0.3
120 0.28
121 0.34
122 0.37
123 0.45
124 0.45
125 0.42
126 0.4
127 0.38
128 0.38
129 0.32
130 0.27
131 0.21
132 0.22
133 0.23
134 0.25
135 0.29
136 0.32
137 0.32
138 0.32
139 0.34
140 0.34
141 0.38
142 0.39
143 0.36
144 0.32
145 0.31
146 0.31
147 0.28
148 0.28
149 0.22
150 0.19
151 0.16
152 0.17
153 0.18
154 0.16
155 0.21
156 0.21
157 0.23
158 0.23
159 0.23
160 0.21
161 0.21
162 0.2
163 0.18
164 0.22
165 0.21
166 0.26
167 0.28
168 0.3
169 0.36
170 0.37
171 0.37
172 0.38
173 0.46
174 0.47
175 0.55
176 0.59
177 0.61
178 0.69
179 0.71
180 0.71
181 0.65
182 0.6
183 0.54
184 0.51
185 0.45
186 0.37
187 0.33
188 0.26
189 0.21
190 0.2
191 0.16
192 0.13
193 0.12
194 0.11
195 0.11
196 0.13
197 0.13
198 0.16
199 0.18
200 0.17
201 0.15
202 0.16
203 0.14
204 0.14
205 0.13
206 0.11
207 0.09
208 0.09
209 0.09
210 0.07
211 0.07
212 0.07
213 0.09
214 0.1
215 0.12
216 0.12
217 0.13
218 0.14
219 0.14
220 0.16
221 0.15
222 0.14
223 0.11
224 0.11
225 0.1
226 0.08
227 0.08
228 0.05
229 0.04
230 0.04
231 0.04
232 0.03
233 0.03
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.04
240 0.06
241 0.07
242 0.07
243 0.07
244 0.08
245 0.09
246 0.1
247 0.12
248 0.12
249 0.12
250 0.16
251 0.19
252 0.19
253 0.19
254 0.19
255 0.2
256 0.25
257 0.34
258 0.4
259 0.46
260 0.52
261 0.62
262 0.72
263 0.8
264 0.85
265 0.85
266 0.86
267 0.87
268 0.91
269 0.92
270 0.9
271 0.89
272 0.87
273 0.85
274 0.78
275 0.7
276 0.63
277 0.57
278 0.49
279 0.45
280 0.36
281 0.3
282 0.27
283 0.24
284 0.2
285 0.15
286 0.14
287 0.09
288 0.1
289 0.09
290 0.09
291 0.11
292 0.11
293 0.11
294 0.11
295 0.12
296 0.12
297 0.15
298 0.19
299 0.23
300 0.31
301 0.33
302 0.36
303 0.44
304 0.48
305 0.48
306 0.49
307 0.52
308 0.49
309 0.54
310 0.56
311 0.56
312 0.56
313 0.52
314 0.47
315 0.47
316 0.52
317 0.5
318 0.55
319 0.56
320 0.61
321 0.69
322 0.77
323 0.77
324 0.74
325 0.75
326 0.76
327 0.75
328 0.71
329 0.66
330 0.64
331 0.64
332 0.6