Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C9N6A1

Protein Details
Accession A0A0C9N6A1    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-67DVLRAKNKALRERRANKKAEKLEARHydrophilic
NLS Segment(s)
PositionSequence
27-36KAKAEKVRAK
45-66LRAKNKALRERRANKKAEKLEA
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035970  60S_ribosomal_L19/L19e_sf  
IPR000196  Ribosomal_L19/L19e  
IPR039547  RPL19  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01280  Ribosomal_L19e  
Amino Acid Sequences HLYHHLYLKSKGNGFKNKRVLMEHIHKAKAEKVRAKTLAEQADVLRAKNKALRERRANKKAEKLEARQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.68
4 0.66
5 0.64
6 0.6
7 0.55
8 0.52
9 0.53
10 0.52
11 0.47
12 0.45
13 0.43
14 0.41
15 0.42
16 0.4
17 0.39
18 0.38
19 0.37
20 0.42
21 0.43
22 0.44
23 0.42
24 0.42
25 0.38
26 0.32
27 0.29
28 0.23
29 0.27
30 0.26
31 0.23
32 0.2
33 0.17
34 0.18
35 0.21
36 0.27
37 0.3
38 0.39
39 0.48
40 0.55
41 0.65
42 0.75
43 0.8
44 0.83
45 0.81
46 0.83
47 0.81
48 0.81