Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MZ84

Protein Details
Accession A0A0C9MZ84   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-32TTMDLSPPQIRKKKNKQHKQRQSRKGLIGSKHydrophilic
NLS Segment(s)
PositionSequence
12-29RKKKNKQHKQRQSRKGLI
Subcellular Location(s) plas 11, mito 10, nucl 3, cyto 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MTTMDLSPPQIRKKKNKQHKQRQSRKGLIGSKAIQKFRDPSSVNVSFFALGIFLFAIFGGSKPYQAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.86
4 0.88
5 0.92
6 0.95
7 0.95
8 0.95
9 0.94
10 0.93
11 0.9
12 0.84
13 0.8
14 0.74
15 0.66
16 0.6
17 0.52
18 0.5
19 0.47
20 0.43
21 0.35
22 0.31
23 0.32
24 0.29
25 0.34
26 0.28
27 0.27
28 0.34
29 0.37
30 0.36
31 0.34
32 0.32
33 0.24
34 0.22
35 0.19
36 0.1
37 0.06
38 0.06
39 0.05
40 0.04
41 0.04
42 0.03
43 0.05
44 0.05
45 0.05
46 0.1
47 0.1