Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9LTC8

Protein Details
Accession A0A0C9LTC8   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MERTCKRRNNGRNKHGRGHNKVVRCBasic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MERTCKRRNNGRNKHGRGHNKVVRCINCYRCVPKDKAIKRFTIRNMVEAAAVRDLQEASIYEEYAIPKLYVKLHYCISCAIHARVVRVRSAVDRRNRLPPPRFRFQKAANKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.87
4 0.84
5 0.84
6 0.8
7 0.75
8 0.75
9 0.74
10 0.68
11 0.62
12 0.61
13 0.56
14 0.56
15 0.54
16 0.53
17 0.51
18 0.54
19 0.54
20 0.54
21 0.59
22 0.6
23 0.64
24 0.62
25 0.63
26 0.6
27 0.63
28 0.59
29 0.59
30 0.52
31 0.43
32 0.41
33 0.34
34 0.31
35 0.24
36 0.21
37 0.12
38 0.11
39 0.09
40 0.08
41 0.07
42 0.06
43 0.06
44 0.05
45 0.08
46 0.08
47 0.08
48 0.08
49 0.09
50 0.09
51 0.1
52 0.1
53 0.07
54 0.07
55 0.09
56 0.11
57 0.15
58 0.17
59 0.19
60 0.22
61 0.23
62 0.23
63 0.24
64 0.23
65 0.22
66 0.23
67 0.21
68 0.22
69 0.22
70 0.25
71 0.28
72 0.27
73 0.25
74 0.23
75 0.24
76 0.27
77 0.34
78 0.38
79 0.43
80 0.5
81 0.52
82 0.61
83 0.67
84 0.69
85 0.7
86 0.73
87 0.72
88 0.75
89 0.78
90 0.75
91 0.77
92 0.77