Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ML83

Protein Details
Accession A0A0C9ML83   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MICRKCYARLPPRATNCRKKKCGRTNQLRPKKKLKQMQDNMCNVHydrophilic
NLS Segment(s)
PositionSequence
30-32PKK
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
Amino Acid Sequences MICRKCYARLPPRATNCRKKKCGRTNQLRPKKKLKQMQDNMCNVGHVQITPQWSVFTMLTKGCSDSQHLTGHHQELKDEPSRTAGVYGLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.85
4 0.85
5 0.87
6 0.87
7 0.88
8 0.89
9 0.9
10 0.9
11 0.91
12 0.91
13 0.93
14 0.94
15 0.93
16 0.88
17 0.88
18 0.86
19 0.84
20 0.81
21 0.8
22 0.8
23 0.8
24 0.83
25 0.81
26 0.74
27 0.67
28 0.58
29 0.49
30 0.37
31 0.29
32 0.19
33 0.1
34 0.08
35 0.08
36 0.1
37 0.1
38 0.1
39 0.09
40 0.1
41 0.12
42 0.11
43 0.11
44 0.11
45 0.11
46 0.13
47 0.13
48 0.15
49 0.14
50 0.15
51 0.18
52 0.19
53 0.22
54 0.25
55 0.25
56 0.28
57 0.31
58 0.34
59 0.34
60 0.31
61 0.28
62 0.27
63 0.31
64 0.34
65 0.31
66 0.27
67 0.28
68 0.29
69 0.28
70 0.26