Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9N250

Protein Details
Accession A0A0C9N250   
Localization Confidence Low
Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
125-148ESPALEPKQKKKGKLCKLFAGIKLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 12.333, nucl 11, mito_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR037381  RFWD3  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:0004842  F:ubiquitin-protein transferase activity  
GO:0036297  P:interstrand cross-link repair  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
Amino Acid Sequences MTNDTAIVALPCGHCFGEQCIEECLLSGSTKCPLCQKSYRHTHVRTLYLPLEEDCDKVYKEKYDELVKKTDDLTKHYEVLKDLCDMTASNAPIVSRVNELVNRMAIAREELKGKAIIGKGSNQTESPALEPKQKKKGKLCKLFAGIKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.17
4 0.21
5 0.21
6 0.22
7 0.22
8 0.23
9 0.22
10 0.21
11 0.18
12 0.12
13 0.12
14 0.11
15 0.1
16 0.15
17 0.16
18 0.17
19 0.22
20 0.24
21 0.3
22 0.37
23 0.42
24 0.47
25 0.56
26 0.63
27 0.64
28 0.65
29 0.67
30 0.65
31 0.63
32 0.55
33 0.49
34 0.44
35 0.36
36 0.33
37 0.25
38 0.23
39 0.18
40 0.17
41 0.13
42 0.13
43 0.13
44 0.14
45 0.15
46 0.14
47 0.16
48 0.18
49 0.21
50 0.28
51 0.33
52 0.34
53 0.36
54 0.34
55 0.33
56 0.32
57 0.31
58 0.24
59 0.23
60 0.26
61 0.23
62 0.25
63 0.25
64 0.25
65 0.22
66 0.22
67 0.19
68 0.14
69 0.13
70 0.1
71 0.1
72 0.09
73 0.1
74 0.13
75 0.12
76 0.11
77 0.11
78 0.11
79 0.12
80 0.12
81 0.11
82 0.08
83 0.09
84 0.11
85 0.12
86 0.14
87 0.14
88 0.14
89 0.13
90 0.12
91 0.11
92 0.1
93 0.11
94 0.11
95 0.11
96 0.13
97 0.13
98 0.15
99 0.15
100 0.15
101 0.17
102 0.16
103 0.18
104 0.18
105 0.23
106 0.26
107 0.28
108 0.3
109 0.26
110 0.26
111 0.25
112 0.24
113 0.22
114 0.23
115 0.23
116 0.31
117 0.38
118 0.45
119 0.54
120 0.58
121 0.64
122 0.68
123 0.77
124 0.79
125 0.82
126 0.81
127 0.8
128 0.82