Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9MGR3

Protein Details
Accession A0A0C9MGR3   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGRRPARCYRYCKNKPYPKSRYCRGVPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001197  Ribosomal_L10e  
IPR016180  Ribosomal_L10e/L16  
IPR036920  Ribosomal_L10e/L16_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00252  Ribosomal_L16  
Amino Acid Sequences MGRRPARCYRYCKNKPYPKSRYCRGVPDAKLRIYDLGRKKASVDDFPLCVHLVSNEYEQLSAEALEAALRRCKYKFPGQQKIIISKKWGFTPLARAEYVEARAAGKLRPDGCYVKFVPQRGPLSNYFKEAAKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.9
4 0.9
5 0.89
6 0.88
7 0.86
8 0.84
9 0.78
10 0.76
11 0.72
12 0.7
13 0.66
14 0.67
15 0.65
16 0.57
17 0.54
18 0.46
19 0.44
20 0.37
21 0.4
22 0.37
23 0.4
24 0.4
25 0.38
26 0.39
27 0.4
28 0.41
29 0.36
30 0.33
31 0.27
32 0.27
33 0.27
34 0.27
35 0.21
36 0.18
37 0.14
38 0.1
39 0.09
40 0.09
41 0.1
42 0.1
43 0.1
44 0.1
45 0.1
46 0.09
47 0.08
48 0.06
49 0.05
50 0.04
51 0.04
52 0.04
53 0.05
54 0.05
55 0.09
56 0.09
57 0.11
58 0.11
59 0.14
60 0.19
61 0.28
62 0.37
63 0.44
64 0.54
65 0.55
66 0.61
67 0.61
68 0.65
69 0.59
70 0.51
71 0.45
72 0.38
73 0.38
74 0.33
75 0.33
76 0.25
77 0.23
78 0.31
79 0.32
80 0.32
81 0.3
82 0.28
83 0.27
84 0.28
85 0.28
86 0.21
87 0.15
88 0.13
89 0.14
90 0.15
91 0.14
92 0.15
93 0.19
94 0.19
95 0.21
96 0.25
97 0.28
98 0.29
99 0.34
100 0.32
101 0.37
102 0.4
103 0.4
104 0.42
105 0.45
106 0.49
107 0.47
108 0.51
109 0.48
110 0.52
111 0.53
112 0.5
113 0.44