Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9LTR7

Protein Details
Accession A0A0C9LTR7   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-88EMNTADKKPSKKQQQKKKDIKHydrophilic
NLS Segment(s)
PositionSequence
74-88KKPSKKQQQKKKDIK
Subcellular Location(s) nucl 14, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR036866  RibonucZ/Hydroxyglut_hydro  
IPR047151  RNZ2-like  
Gene Ontology GO:0042781  F:3'-tRNA processing endoribonuclease activity  
GO:0046872  F:metal ion binding  
Amino Acid Sequences MNAKFTLLNHFSQRYPKLPILSEEQSNVCFSFDLMSIPMKQIPLLPKFTNAIQLAFKDEEAEEDKDIEMNTADKKPSKKQQQKKKDIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.42
3 0.42
4 0.4
5 0.39
6 0.4
7 0.39
8 0.38
9 0.35
10 0.31
11 0.28
12 0.25
13 0.24
14 0.22
15 0.15
16 0.11
17 0.1
18 0.09
19 0.08
20 0.08
21 0.08
22 0.09
23 0.09
24 0.09
25 0.1
26 0.09
27 0.09
28 0.11
29 0.14
30 0.16
31 0.2
32 0.2
33 0.2
34 0.21
35 0.22
36 0.25
37 0.21
38 0.2
39 0.17
40 0.17
41 0.19
42 0.18
43 0.18
44 0.12
45 0.12
46 0.13
47 0.15
48 0.17
49 0.14
50 0.14
51 0.14
52 0.14
53 0.14
54 0.12
55 0.09
56 0.09
57 0.12
58 0.15
59 0.18
60 0.22
61 0.27
62 0.36
63 0.46
64 0.55
65 0.63
66 0.7
67 0.79
68 0.85